SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000011913 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000011913
Domain Number 1 Region: 390-690
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.27e-65
Family Protein kinases, catalytic subunit 0.000000574
Further Details:      
 
Domain Number 2 Region: 257-345
Classification Level Classification E-value
Superfamily Kringle-like 3.87e-30
Family Kringle modules 0.00031
Further Details:      
 
Domain Number 3 Region: 9-100
Classification Level Classification E-value
Superfamily Immunoglobulin 1.95e-21
Family I set domains 0.028
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000011913
Domain Number - Region: 158-209
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0068
Family Frizzled cysteine-rich domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000011913   Gene: ENSGMOG00000011137   Transcript: ENSGMOT00000012234
Sequence length 887
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3730:34578:44574:-1 gene:ENSGMOG00000011137 transcript:ENSGMOT00000012234 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPPGFYLRFLGPVNNITHFQGQTATLHCRVSGNPWPTIRWLKNDAPVVQEQGRISIRKTD
SGSKLRITDLDTTDTGYYQCLATNTLKVISNTGVLYVKLGQLPTHGPVEXXXXXTPAKGF
CQPYRGIACARFIGNQSIYVESLQMQGESENRITAAFTMIGTSTHLSDDCSQFAIPSFCH
YVFPLCDEEARGPHRRQLCRDECEALEDDLCHAEYTIARSNPMILMQLELPSCHLLPPPA
SPDAASCMRIGVPAESLNPNHSCYNGSGAQYKGTLSVTKSGYLCQPWGTHYPHKHHLSQE
YPELRGGHNFCRNPGGQMQGPWCFTLDPQVRVDLCEIYPCKPPDNLKKEILYILIPSIAL
PLVIACLFFLFCMCRNKQKGNTDTPPRRQLAASPSQDMELPLLNQQKHHPTREISMSTLH
FMEDLGEDRFGKMYKGHLYGAAHGEQSQVVAIKTLKDKADAALCEEFRQEGVLRARLQHH
NVLCLLGVVTKEQPVSMVFGYSGRGDLHEFLVVHSPHSDVGGSDDDRTVKSTLEQADFLH
IVTQIAAGMEYLSNHQVVHKDLAARNILVCDKLNVKIQDLGLSRDVYSADYYNLFGSNSF
PVRWMSPEAIMYGKFSTDSDIWSFGVVLWEIFSYGLQPYCGYANQDVVEMVQGRQFLACP
DDCPAGTYTLMLDCWSEFPTSRPRFKNIHARLRTWESASSYNSSAQTASTSNTTQTSSLS
TSPVSNVSMGTANASRYASPKKSLPPYPHPQFMPMKGQMHRPMMPQQIYIPVNGYPPMQA
YPYMQNFYPMQIPMPMAHQQMHHPTPLVAKAGSHHSGSGSTSTGYVTTLPSSSGGAERAA
AFNDSKASDEDLADGSSQKEGDQNAEFQPVPETELLGDNEAVQEDIV
Download sequence
Identical sequences ENSGMOP00000011913 ENSGMOP00000011913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]