SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000011965 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000011965
Domain Number 1 Region: 405-666
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.25e-76
Family Protein kinases, catalytic subunit 0.0000000578
Further Details:      
 
Domain Number 2 Region: 846-986
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 2.35e-54
Family FAT domain of focal adhesion kinase 0.0000107
Further Details:      
 
Domain Number 3 Region: 135-256
Classification Level Classification E-value
Superfamily Second domain of FERM 1.02e-36
Family Second domain of FERM 0.0000217
Further Details:      
 
Domain Number 4 Region: 33-133
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.03e-33
Family First domain of FERM 0.00028
Further Details:      
 
Domain Number 5 Region: 257-361
Classification Level Classification E-value
Superfamily PH domain-like 1.14e-25
Family Third domain of FERM 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000011965   Gene: ENSGMOG00000011174   Transcript: ENSGMOT00000012287
Sequence length 988
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2494:700809:720877:1 gene:ENSGMOG00000011174 transcript:ENSGMOT00000012287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGDTRTLSWKVPSPGANHSPISPETSITGDGGPVKILKVCFSTNNNLGKNFKLVKCDSS
TQIRGIIQSILGSGRLGPNILHSACYGLLLTHLKSEDLHWLHPDLTVEEVEQRYESQHAE
AEWRYDLRIRYIPVNFLEKFDQDRTTLFYFYRQVRTEYMEIHASKVSDGMAMQLGCLEIR
RFYKDMNAKGLEKRSNFELLEKEVGLELFFPKNLIDSMKSKHLRKQIQQTFQQYATLKEE
ECMRKFFVALREVVNYDEEVFPCELVQGWSLAVELVIGARGIRQRQQKDAAPVFLADFKH
IKSIKCLAQNDGKALVTLEVEGVRQLSINTATFSMAENMADLIDGYWRLEKGTEESCISR
PNKDVNTQSSLPEIPKESSKESSNFRYSSDIYCEIMDERPKSAVKYGIDRADISLGQILG
SGFFGEVYEGVYKNLNGDKTSVAVKTCKDCSPDVMEKFMSEALIMKNLNHPNIVKLIGII
EDDPVWIVMELYPFGELGSYLAKKQDELTNITLVLFSLQICKALVYLGGVNMVHRDIAVR
NVLVASADCVKLGDFGLSRYIEEEEYYKASVTRLPIKWMAPESINFRRFTSASDVWMFAV
CLWEILSRGQQPFFWLENRDVINQLEQGIRLPKPEQCPPALYSLMTRCWSYDPRERPTFT
DLVIKISDVHNMEIEQDVERQRDRARTTKVFESKFNFNEPPPKPSRMKPGRFGNMLSIGL
HIQLNEALCASSPDLASPSNYQSPLDSMNALMPPALSPRRRSMGEGEFPRVEASSKEEAQ
RLWQQERDHRHDTLRRQKREMAEDEQWLEKEERLLDPMGPEEGPPTASPDAEEEHAPEKP
PRLTAQQAPTAELDRSGDKVYQSVMDLVKVVVELKNDIPTMHPDEYIGIVKSVGMTLRDL
IHSVDELMPTIHESVRTELEGTQKLLNNDMAELISKMRLAQQNAITSLKEECKKQMLAAA
HTLAIDGKNMLDAVDQGRVRANQAKPKP
Download sequence
Identical sequences ENSGMOP00000011965 ENSGMOP00000011965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]