SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000012016 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000012016
Domain Number 1 Region: 574-662
Classification Level Classification E-value
Superfamily PH domain-like 6.76e-18
Family Third domain of FERM 0.0043
Further Details:      
 
Domain Number 2 Region: 381-474
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000274
Family Pleckstrin-homology domain (PH domain) 0.007
Further Details:      
 
Domain Number 3 Region: 277-322
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000903
Family Second domain of FERM 0.011
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000012016
Domain Number - Region: 540-573
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000209
Family Second domain of FERM 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000012016   Gene: ENSGMOG00000011237   Transcript: ENSGMOT00000012341
Sequence length 685
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2007:1605484:1644483:1 gene:ENSGMOG00000011237 transcript:ENSGMOT00000012341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALDGIRMPDGCYADGTWELKMHVTDLKRDVSLRVTGEIHIGGVMLKLVEKLDVKKDWSD
HALWWEKKKTWLLKTHWTLDKYGIQADARLLFTPQHKLLRLQLPNMKHMKVKVNFSDRVF
KAVSDICKTFNIRHPEELSLLRKPRDPKKKKKKLEEAEEEALELEGPMLTPGSGSIYSSP
GLYSKTMTPTYDSRDGSPLSPTTAWFGDSPLSEGNPSILAVSQPISSPDILVKLYKPQSL
LDKAKINQGWLDSSRSLMEQDVKENEVLLLRFKYHSFFDLNPKYDAIRVNQLYEQAKWAI
LIEEIECTEEEMMMFAALQYHINKLSIMSSDHHMNNSEKEVDEVDAALSDLEITLEGGKT
SNTLGDITSIPELADYVKIFKPKKLTLKSHKQYWCTFKDITVSCYKTKEEAHGTPALQMN
LRGCEVTPDVNISGQKFNIKLLIPVADGMNEIWLRCDMEKQYAHWMAACRLASKGKTMAD
SSYNLEVQNILSFLKMQHMNPDPQYIAEPITTDINPECLVSPRYLKKYKNKQPGFIRDLI
SARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFLAKFQGGKREELIGITYNRLIR
MDASTGDAIKTWRFSNMKQWNVNWEIKMVTVEFADEPSLAFICAEVDCKVVHEFIGGYIF
LSTRAKDQNESLDEEMFYKLTSGWV
Download sequence
Identical sequences ENSGMOP00000012016 ENSGMOP00000012016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]