SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000012084 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000012084
Domain Number 1 Region: 1130-1224,1252-1480
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 2.62e-102
Family Hect, E3 ligase catalytic domain 0.0000000378
Further Details:      
 
Domain Number 2 Region: 168-278
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000152
Family Synaptotagmin-like (S variant) 0.037
Further Details:      
 
Domain Number 3 Region: 726-760
Classification Level Classification E-value
Superfamily WW domain 0.0000000000139
Family WW domain 0.0014
Further Details:      
 
Domain Number 4 Region: 900-941
Classification Level Classification E-value
Superfamily WW domain 0.000000000167
Family WW domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000012084   Gene: ENSGMOG00000011288   Transcript: ENSGMOT00000012410
Sequence length 1486
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1897:161660:203719:1 gene:ENSGMOG00000011288 transcript:ENSGMOT00000012410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPDNLRTLAERGGAANADSVSGASGPMGLPRANSDTDLVSSQSRSSLTASTLEFTLNRGQ
NLVISWDIKEEVDATDWIGLYHIDETSPSNVWDCKNRGVNGTQRGQIVWRLEAGPYFMEP
ETKVCFKYYHGVSGALRATTPCITVKNPGVLVEGLSEQVGTDHPRKLISFTLTDLRATGL
KKGMFFNPDPYLKMSIHPGKRSMFPTFSHHGQERRSAIIANTTNPVWHGEKYTFVALMTD
ILYIEVKDKFAKSRPIIKRFLGQLTIPVQRLIEKIPGVQPVSFSLCRRLPTEHVSGQMQF
RVELTSTGPDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXEEEGLPDLDPGLDDISEPDVFSEVDETPFTEAMS
HHALQGSLEEQEEGRALGEDPLSEMDSCSMATAPQTVVSSSESCPITMTTAVVRCLLLHI
YDTEEGAETALDPGGPAVLDILPSIQDAVDTISVQTPANQAEAQPIRNPAQVAERRRSLQ
ASGGVAEEQVEGAESRTPKEVGPVDSDQAATETDGEEGAGSQVNGHPVRSSLPTVRHDMH
RYQRVDEPLPPNWEARIDSHGRIFFVDHVNRTTTWQRPTGPPAPQGLTRSSSIQQMEQLN
RRYQSIRRTITNADRTEENPVDPPPDAADSDLLPHAIHXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXSAYRMFTSNTCLKHMISKVRRDAHHFERYQHNRDLVAFLN
LFSNKQLELPRGWEMKHDHTGKPFFVDHNCRSTTFIDPRLPLQSSRSTGLLAHRQHLSRQ
RSHSAGEVVDDSRQSNQPILPRPSSTFSGSSRNQYQDLVPVAYNDKIVAFLRQPNIVDIL
QERQPELARNHSLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLFEEDVMSYVPPHALLH
PGYALSSPQSSPGTQRANARAPAPYKRDFEAKLRNFYRKLETKGYGQGPGKVIIRRDHLL
EDAFNQIMCYSRKDLQRSKLYVGFVGEEGLDYSGPSREFFFLVSRELFNPYYGLFEYSAN
DTYTVQISPMSAFVDNHHEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPCELSDL
EFLDEEFHQSLQWMKDNDIEDMLDLTFTVNEEVFGQITERELKVGGANIAVTEKNKKEYI
ERTVKWRIERGVVQQTESLVRGFYEVVDVRLVSVFDARELELVIAGTAEIDLADWRSNTE
YRGGYHDNHIVIRWFWAAVERFNNEQRLRLLQFVTGTSSIPYEGFASLRGSNGPRRFCVE
KWGKITSLPRAHTCFNRLDLPPYPSFSMLYEKLLTAVEETSTFGLE
Download sequence
Identical sequences ENSGMOP00000012084 ENSGMOP00000012084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]