SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000012134 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000012134
Domain Number 1 Region: 69-278
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.72e-46
Family DBL homology domain (DH-domain) 0.0000809
Further Details:      
 
Domain Number 2 Region: 300-412
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000889
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000012134   Gene: ENSGMOG00000011344   Transcript: ENSGMOT00000012460
Sequence length 423
Comment pep:novel genescaffold:gadMor1:GeneScaffold_904:74138:81899:1 gene:ENSGMOG00000011344 transcript:ENSGMOT00000012460 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EPSTKRTRSISKVSSLINLLPPVKTAPLKRIGQTLQRSISFRNDRRTENQTRPLATGAAA
SSSKRRDSKLWSETFDTGHGTPQMLSPQDIRRQEAIFELAQGEQDLVEDLHLARKAYHDP
MLKLSIMTEQELNQIFGTLNSLIPLHEDLLCQLRDARNPDGSTELVGPILTHWQLPCLRQ
YTGYCSKQLAAKSLLDRRKQDPRVEDFLLRCLQSPFSRKLDLWNFLDIPRSRLVKYPLLL
REIQKHTANEHPDKPYLDQAMVQGLLSDINQRTGEAECQYFKERLVYGQKSWRDGMVECS
TTLCCHGELKNTRGXKLHVFLFQDALVITRSSSLNDQPISYQLCHQPIPIQQLVLEDLQD
GEMRVGGSIRGAFSNNERSKNFLRLSSPRGQQSHCLQASDAFNKQQWINCIRLAKEAAVL
DVE
Download sequence
Identical sequences ENSGMOP00000012134 ENSGMOP00000012134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]