SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000012149 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000012149
Domain Number 1 Region: 319-481,904-1050
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.05e-119
Family Mammalian PLC 0.00000865
Further Details:      
 
Domain Number 2 Region: 626-742
Classification Level Classification E-value
Superfamily SH2 domain 3.9e-31
Family SH2 domain 0.00000841
Further Details:      
 
Domain Number 3 Region: 1059-1182
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.51e-25
Family PLC-like (P variant) 0.0014
Further Details:      
 
Domain Number 4 Region: 533-646
Classification Level Classification E-value
Superfamily SH2 domain 4.98e-25
Family SH2 domain 0.00053
Further Details:      
 
Domain Number 5 Region: 774-843
Classification Level Classification E-value
Superfamily SH3-domain 1.04e-20
Family SH3-domain 0.0000681
Further Details:      
 
Domain Number 6 Region: 28-143
Classification Level Classification E-value
Superfamily PH domain-like 5.48e-18
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 7 Region: 153-309
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000922
Family Calmodulin-like 0.042
Further Details:      
 
Domain Number 8 Region: 479-515
Classification Level Classification E-value
Superfamily PH domain-like 0.0000356
Family Pleckstrin-homology domain (PH domain) 0.00093
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000012149
Domain Number - Region: 856-910
Classification Level Classification E-value
Superfamily PH domain-like 0.0511
Family Pleckstrin-homology domain (PH domain) 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000012149   Gene: ENSGMOG00000011348   Transcript: ENSGMOT00000012475
Sequence length 1258
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2823:38862:76025:-1 gene:ENSGMOG00000011348 transcript:ENSGMOT00000012475 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AEEASPGGATAPARAPVSRLVDWNEAWPRVLHALEVGTVMTVFYQKSQRPERRTFQIRQD
TRQMVWSRNDKVEGEIELREVRELRRGKGSRDFERYPEESRRLEASHCFIVLYGSEFRLK
TLSVAAFSEEEVTMWMSGLSWLVSNTQKAPLPQLIDRWLRKQFDAIDRSNEGSITVKDVK
TLLPQINFRVPSMRFLKDKLQEVEARSDLSYPNFSQLYRTLMFDAQRSLDLSFPLRNVDR
PELCQISLYDFQKFLQLDQKESWASDLGRVREVLLAYLLGSAQSEPMLQLDEFLTFLFSK
ENSVFDPRPSPVAPDDMKRPLSQYWISSSHNTYLTGDQFSSESSLEAYARCLRMGCRCIE
LDCWDGPDDLPIIYHGHTLTSKIKFLDVLHTIKDHAFVTSEYPVILSIEDHCSVVQQRNM
ATHFKKVFGDLLLTKPVETGADELPSPYQLRRKILIKHKKLEEGTMYEEVTSASYSENDI
SNSLKNGILYLQDPIDHAWTPHYFVLTSNKIYYSEETSHYQTECNNNDQPGVERWFHGKL
GGGRDGRQVAEKLLQEYCEGGAKDGTFLVRESETFVGDYTLSFWRSGRVQHCRIHSRQES
GSTRFYLTDNLVFASLQRLISHYRHTPLRCNEFEMALCSPVPQPNAHESREWFHSNLSRV
QAEHMLMRVPRDGAFLVRKRSEVHSYAISFRAEGKIKHCRIHQEGRLFMLGSSAEFESLV
DLVRYYEKHPLYRKMRLRYPINEDALDRMGTTELDYGALYEVRTPHFYVEANKMPMARCT
VKALYDYRAQREDELCFPKQALILNVDKQEGGWWRGDYGGKKQLWFPANYVEEVPSSPTR
EPDEALQASENSPLGTFLKGFVDVPSCHAGELSSRPVQTLDVAADSLEDLTAWVAKIREA
AQNADARMQEEKQMERRKKIAVELSDLVVYCRPVPFNEEKIGTERACYRDMSSFPETKAE
RLATRSRGRRFLQYNRRQLSRVYPRGQRLDSSNYDPLAMWLCGSQLVALNFQTPDKPMQM
NQALFMLGGGSGFVPHPDVMRDDSFDPFDKETLRLEPITIQLQVLGARHLPKTGRSIVCP
FVEVEISGADYDSCKSKTDVVADNGLNPAWLQTPFVFDVRNPSFCFLRFTVYDEDMFSDP
NFLAQATYPVRSLRTGYRSVPLKNSYSEELELASLLVHIEIVNAKEEDDQNLYTSIQRLR
DLTSQLSNQVSTLERSGSGDQSYQQSLEELRDAQDQLSELVDGEEEEREAEATVGHEA
Download sequence
Identical sequences ENSGMOP00000012149 ENSGMOP00000012149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]