SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000012266 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000012266
Domain Number 1 Region: 345-612
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.35e-71
Family Protein kinases, catalytic subunit 0.0000000154
Further Details:      
 
Domain Number 2 Region: 5-147
Classification Level Classification E-value
Superfamily PH domain-like 6.3e-44
Family Pleckstrin-homology domain (PH domain) 0.00000525
Further Details:      
 
Domain Number 3 Region: 240-385
Classification Level Classification E-value
Superfamily SH2 domain 1.97e-30
Family SH2 domain 0.0001
Further Details:      
 
Domain Number 4 Region: 170-261
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000328
Family SH3-domain 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000012266   Gene: ENSGMOG00000011470   Transcript: ENSGMOT00000012593
Sequence length 619
Comment pep:novel genescaffold:gadMor1:GeneScaffold_65:402802:412727:1 gene:ENSGMOG00000011470 transcript:ENSGMOT00000012593 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMASSIMEECFIKRSQQKKKTSPLNYKERLFVLTQEKLSYYEYDQDKGRRKSLRGTVDLQ
KVKCVEKVYPEHHAPTERLYPFQVIYDDGPLYIFAKNGEIQSEWIRKLKEIVRYNKDLKQ
KYHPCFWVDGQWQCCQQEVKQAMGCRVLQQEPAVQTLSLEPPKPSLSVGMTVIAEHEYIP
LSAQDLELKKDEEYTILEMPDANWWRARDKYLVHNVSLFFYYRREGYIPNNYVVQAGNVL
ERYPWYCKNMNRSQAENLLKTENKDGGFVVRDSRLKAGQYTVSLFSKISGETAGSCRHYN
ICTTSQGQFYLADKHFFSTIPELITYHQHNAAGMVSRLKIIVSNRAHAPSTAGLGYGMWE
INPRHLTFIKELGNGQFGVVKYGKWQGQHDVAIKMIKEGSMSENHDVGHVIIIMKLCHEN
LVQLYGVCTKQRPIYIVTEFLSNGCLLTYLKEGLKQHPTNIQLLEMCKDVAEGMAYLESN
QYLHRDLAARNCLVDTNGTVKVTDFGLSRYVLDDEYTSSEGSKFPVRWSPPEVLLYRKFS
SKSDIWAYGILMWEIHTLGKLPYERLDNQAIVDQVSKGYRLYRPQLANERVYSIMKSCWP
EKAEERPTFQELAVNVQDL
Download sequence
Identical sequences ENSGMOP00000012266 ENSGMOP00000012266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]