SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000012270 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000012270
Domain Number 1 Region: 7-394
Classification Level Classification E-value
Superfamily Ras GEF 3.4e-90
Family Ras GEF 0.0006
Further Details:      
 
Domain Number 2 Region: 415-498
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000114
Family Calmodulin-like 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000012270   Gene: ENSGMOG00000011473   Transcript: ENSGMOT00000012597
Sequence length 608
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4217:42499:72138:1 gene:ENSGMOG00000011473 transcript:ENSGMOT00000012597 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METTSTEQAATVEDLVESCIQAFDEKGALKDSSVVRMFLMMHPWYLPSTDMAKRLVLKYP
SSPCTTCEVCMKSDKSRKYWISEFPAEFNLNPELAEQIKDLKDQLVTEGNESQSQLIDID
SVPSYKWKRQVTQRVPSISKKRKMSLLFDHLDSCELAEHLTYLEYKSFCKILFQDYHSFV
MHGCTVDNPVLERFITLFNSVSQWIQLMVLSKPTAPQRAAVVSHFIRVAQKLLQLQNFNT
LMAVVGGLSNSSISRLKETQAHISADTNKVFNDLIELVTSCGNYSQYRRRFADCTGFRFP
ILGVHLKDLIAVHVALSDWADKEKSRVNLAKTQQLYAILQELALVQTTAPSIDANTDLLN
LLTVSLDQYHTEEEIYQMSLQREPRSTKPAPNSSVSAPQPDPKPTMIDEWAGSVKPSADP
TVIRKHIEQMVESVFKNFDADGDGHISQEEFEAIRNNFPYLSKFGELDKNQDGKISREEM
IDYFMKASSLLNCKMGFIHTFTEATYVKPTFCENCAGFXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIAEEDIETVE
EGVFDIHL
Download sequence
Identical sequences ENSGMOP00000012270 ENSGMOP00000012270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]