SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000012378 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000012378
Domain Number 1 Region: 124-275
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.17e-28
Family Reductases 0.014
Further Details:      
 
Domain Number 2 Region: 24-92
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 0.000000000117
Family Ferredoxin reductase FAD-binding domain-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000012378   Gene: ENSGMOG00000011578   Transcript: ENSGMOT00000012707
Sequence length 275
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1465:152244:158169:-1 gene:ENSGMOG00000011578 transcript:ENSGMOT00000012707 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMSSKRQMDHLEKTSKDYRQNAVYPAQVCGIIQESDTVKRLRISVHPDFTFKAGQWVDFF
IPGVEKVGGFSMCSCPGLLQREGVIELAVKKALHPPAHWIHTAXXXXXXXXXXXXXXXXX
XPRPTDPPADLLLVAGGVGINPLYSVLLHAAHLARQHHASGGRDYRMGSAHMLYSAKSVQ
ELLFKNTILELSREFPGQFSCDLRVTEPSQDPARDQDILPVTRRGRITEADLRAHVDPQR
TLCYLCGPPPMIEAISQSLIDLGLPKDRILFEKWW
Download sequence
Identical sequences ENSGMOP00000012378 ENSGMOP00000012378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]