SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000012423 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000012423
Domain Number 1 Region: 5-59,91-148
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000129
Family V set domains (antibody variable domain-like) 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000012423   Gene: ENSGMOG00000011621   Transcript: ENSGMOT00000012752
Sequence length 543
Comment pep:novel genescaffold:gadMor1:GeneScaffold_770:81306:87436:1 gene:ENSGMOG00000011621 transcript:ENSGMOT00000012752 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SELFAIQVIVTETERTTFLFGSVILRCDYSTSANAQDVLVTWRYKSFCKDPVLEYYSTVY
QAALSLGQDPANDCPDRQRTLRTVVQKRGTNEAMLGAEYRERKITILNKADLAITEVMWW
DNGMYFCTIDAPGDTVGDSDREIKLIVYHWLTVLFIILGALLLILLLGVCCCQCCPQKCC
CYIRCPCCPRTCCCPEKAVMQHRMIRDVQKGMAPWMHGQPMYAPVSSNVSSHGQPVLYSN
SFSEYPTKQNFAMAPIGMQPMPLFQQPPPPEHHGYHGSDGMHGAHQDPNQMLDFLEHQVR
GMDVPVMVAPQPMQHLPQAVPRRQPTHPPPHAVPFSSGPPSMLSALDEMGVRGVERRVIT
LPPIFQHPPSRRGPGAGEEVRGGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDRSSRSGIS
VVI
Download sequence
Identical sequences ENSGMOP00000012423 ENSGMOP00000012423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]