SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000012425 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000012425
Domain Number 1 Region: 307-621
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 7.67e-127
Family Mammalian PLC 0.000000000949
Further Details:      
 
Domain Number 2 Region: 144-304
Classification Level Classification E-value
Superfamily EF-hand 7.99e-44
Family EF-hand modules in multidomain proteins 0.00000279
Further Details:      
 
Domain Number 3 Region: 13-142
Classification Level Classification E-value
Superfamily PH domain-like 1.29e-39
Family Pleckstrin-homology domain (PH domain) 0.00000639
Further Details:      
 
Domain Number 4 Region: 848-971
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 2.22e-24
Family C-terminal domain of PLC-beta 0.00025
Further Details:      
 
Domain Number 5 Region: 640-758
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.41e-18
Family PLC-like (P variant) 0.000019
Further Details:      
 
Domain Number 6 Region: 1021-1075
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 0.00000523
Family C-terminal domain of PLC-beta 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000012425   Gene: ENSGMOG00000011613   Transcript: ENSGMOT00000012754
Sequence length 1098
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1263:610401:637246:-1 gene:ENSGMOG00000011613 transcript:ENSGMOT00000012754 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTKKRYVLEPPQVKGYLVKGERFVKWSEDSTKTGPVTMKMDPKGYYLYWTNQSKETTFL
DVAHIRDTRIGKYAKLPKHPKVRNVFNLDFPDSNHLSKSITIVTGMDMVNLTYYNFFASK
EKITPNWAADVLAIAYNASRNNSCRQIFLDKIFVRICIHTNKDGKIPVKHIYKMFPADKK
RVESALAAAHLPKGKYDTIKPDVFTEAAFKIFLMNLCPRPEIYEIFSTYTAKPFMTKDIF
TKFLNEKQRDSRLNEELFPRLRADQIKALIEKYEPGSNKQISPEGLMFYLMGSETSIIIQ
DRLATCNDMTQPIPHYFIKSSHNTYLTAGQFSGVSTPEMYRQCLLSGCRCLELDCWKGKP
PDEEPYITHGFTMTTEILFKDVIEAINESAFKTSPFPVVLSFENHVDSVKQQEKMANYCR
TIFGDALLTEPLEKYPLKPGQQIPSPSELMGKILIKNKKGHDKPAAAAVDENEEQDDADE
QDEEKMKTSDEGTAGQEVTAYEAMSSIVNYIQPNKFMSFENSKKKNKSYGISSFVETKGE
AMIAKSAVEFVEYNRRQMSRIYPKGTRMDSSNYNPQPFWNAGCQFVALNYQTMDFPMQLN
MALFEYNGRSGYLLKHDVMRRSDKKFDPFCERIDTIIANTLSIKIYSGQFLSDKSVKTGV
EAEIIGLPGDPKKKFRTKWTATANAINPVWNEEPFVFEKILLPEMASLRLVVHEENGKFL
GHRILPLDAIQSGFQHIALRSEGNMVLTLPALFVYIEIKDYIPAAFADFTDALFNPTKEA
EDPKLKKNPKLKKPKAEEEPKAAEEPKAAEEPKAAEEAEVIPEAALEPAPAPNLSPPGPV
SEPDPGVAADPITVSVEELLQHKNYIKVTKRQEKEIKELEKKLQKKQEDLIQKSTDSFKA
YKKKGSLKKKGGGFDPAKEQKEKLQGDLNTLLEDQCNQMKKKKDTHATEKLAKLLELATE
KHTSEMKTLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDNSL
QQEALTKKQAATLEEIKALANQFNKESLDERETRMRSLPAEVKKATNACLSDHYPELVDN
SEDKKTEGENTYGDVFMG
Download sequence
Identical sequences ENSGMOP00000012425 ENSGMOP00000012425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]