SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000012488 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000012488
Domain Number 1 Region: 150-183
Classification Level Classification E-value
Superfamily WW domain 0.0000000000653
Family WW domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000012488   Gene: ENSGMOG00000011676   Transcript: ENSGMOT00000012818
Sequence length 553
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3051:46699:65771:-1 gene:ENSGMOG00000011676 transcript:ENSGMOT00000012818 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
STRSEGREAPPRHTHTHITTAMVMHARKPARVSDGCTDRRHSQPYQPHKSQPKSQSGSVH
RYDKVRDGSSEPTPPYKMLRRSDESPVSRPGDGTVGGHGRAKTTHTLGGKNGTSGSPQEN
PHNNNGAQHSSDSQAPQSRPTERRQEPADDWTEHISSSGKKYYYNCRTEVSQWEKPRDLL
EREQRQKDSSKTTNSFPRDMDYRQEALQDKATAXXXXPSSESTSGDQPTGPNNTASQSLS
SALPSTPASSAAVQAQSSALLQDPAILHQLLPALQATLQMTNGSVDMAKINEVLAAAVTQ
ASLRSMLHKLLAAGPSGYNVTALLSQAAAAAQHSSQEPAQQSSQSPVSLSSDTPSPRPYS
SPRSTSTQSSASAGQKPMTGGGSASSAPSQSRVSHLDKSGAALMSQSSVEKRPEDPRTLQ
LRSSQENPSPGPNACGAGMAAASSTSSCGASQSQPSAPGSFTPSLATHFDENLIRHVQGW
PGEHTEKQAARLREDFHNMGSLYMSEICTELKNLRSLVRVCEIQATLREQRILFLRQQSK
ELDKLKNQNSYMV
Download sequence
Identical sequences ENSGMOP00000012488 ENSGMOP00000012488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]