SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000012511 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000012511
Domain Number 1 Region: 55-485
Classification Level Classification E-value
Superfamily Sema domain 3.92e-142
Family Sema domain 0.000000000779
Further Details:      
 
Domain Number 2 Region: 481-532
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000575
Family Plexin repeat 0.0024
Further Details:      
 
Domain Number 3 Region: 547-629
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000189
Family V set domains (antibody variable domain-like) 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000012511   Gene: ENSGMOG00000011696   Transcript: ENSGMOT00000012841
Sequence length 714
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4095:610:44113:1 gene:ENSGMOG00000011696 transcript:ENSGMOT00000012841 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSDLQESGSFQHFGLEDRAADCRILHMDEDQDXXXXXXXXXXXXXXXXXXXXXXXXVFWP
ASPSKIQECQMAGKDPTHGCGNFIRVLQPYNRTHLFMCGSGAYSPVCIYVNRGRRPEEQV
FHIDRQTESGKGRCSFNPQVNTVSVMINQELFSGVYIDFMATDAAIFRSLTRRNAVRSDQ
HNSKWLSEPVFIDAQLIPDGSDPNDAKLYFFLRERLTDHSGNTKSLHTLLARVCPNDVGG
QRSLVNKWTTFQKARMVCSVQEEDGTETYFDELESVFLLEAEQPQGLLVFGVFTSTSSVF
KGSAVCVYNMADILTVFNGPFAHREGPNFQWVPFQGRIPYPRPGTCPGGAFTPDIQSTKE
FPDDVVTFVRNHPVMFNPVYPVGRRPLVVRTGANYKYTSVAVDQVAAADGNYQVLFLGTX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXNQVPVTNLRISSKKQQLYVSSDHGVSQVSLH
RCQAYGEACADCCLARDPYCAWDGLSCSRFYPTGKRRSRRQDIMHGNPLTQCRGFNLKAY
RNAVERTQYGVRNNTTFLECSATAPRSSIRWLIQRDNDRRKEVKLSERVLSTEHGLLVRA
AQASDQGLYYCLATENAFKRTVAKIRLRVLSPAMVSLLSDTPPPAPPGPGALLAGFSPSE
SLAVQQYCKERRQLQDQVPGRPGSPGTLPGGDQAKLKPLLDRRKSRNRRNHLPE
Download sequence
Identical sequences ENSGMOP00000012511 ENSGMOP00000012511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]