SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000012637 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000012637
Domain Number 1 Region: 35-161
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 1.57e-56
Family N-terminal domain of cbl (N-cbl) 0.000000304
Further Details:      
 
Domain Number 2 Region: 248-334
Classification Level Classification E-value
Superfamily SH2 domain 4.18e-48
Family SH2 domain 0.00000241
Further Details:      
 
Domain Number 3 Region: 340-420
Classification Level Classification E-value
Superfamily RING/U-box 2.87e-41
Family RING finger domain, C3HC4 0.0000102
Further Details:      
 
Domain Number 4 Region: 163-247
Classification Level Classification E-value
Superfamily EF-hand 2.04e-37
Family EF-hand modules in multidomain proteins 0.00000769
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000012637
Domain Number - Region: 847-880
Classification Level Classification E-value
Superfamily UBA-like 0.000121
Family UBA domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000012637   Gene: ENSGMOG00000011805   Transcript: ENSGMOT00000012971
Sequence length 893
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1739:348372:381711:-1 gene:ENSGMOG00000011805 transcript:ENSGMOT00000012971 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGNLKKGGGLIGMMKDAFQPHHHHLHAHHQPGAVDKKTVEKCWKLMDKVVRLCQNPKLA
LKNSPPYILDLLPDTYQHLRTILSRYEGKMETLGDNEYFRVFMENLTKKTKQTISLFKDG
KDRMYEENSQPRRNLTKLSLIFSHTLAELKAIFPNGLFQGDNFRITKADAAEFWRQAFGD
KTIVPWKVFRQSLHEFHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWSSLLR
NWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRLGQWAIGYVTADGNILQ
TIPHNKPLFQALIDGFREGFYLFPDGRTQNPDLTGLCEPSPQDHIKVTQEQYELYCEMGS
TFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESEGQGTGCPFCRCEIKGTEPIVVDPF
DPKDNGAGYCRGMFGAEGAPSPCYDDDDDDRLEDPHLMMSKLACSKVERPPSPMSLTPQA
SLPPVPPRLDLLQHRPASASGASSPVVSTKAATHHKDKPLPPPPALRDLPPPPPPDRPXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSGLGGEI
RGGGIRELSNRHSLPLALPSALDPPPAPLRNSSTISLDHQLDSSKVKPSASANAIYSLAT
CESDEESAYMVPSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXYSELPALVLSQSAEKEEEALYDIPRSVATSRQPPAETSSSSSRL
VFSDLSLDIESRAATXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGGGGAGE
DPVISGEIEHLISQGYSSQDIQKALMIAQNNVEMARNILREFVSVPANAHMLT
Download sequence
Identical sequences ENSGMOP00000012637 ENSGMOP00000012637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]