SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000012687 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000012687
Domain Number 1 Region: 40-150
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000111
Family V set domains (antibody variable domain-like) 0.022
Further Details:      
 
Domain Number 2 Region: 155-242
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000283
Family I set domains 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000012687   Gene: ENSGMOG00000011862   Transcript: ENSGMOT00000013021
Sequence length 382
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1739:753067:759748:-1 gene:ENSGMOG00000011862 transcript:ENSGMOT00000013021 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVERKTSPRHRATGVPPLLTFLGLSLPLLFTGGVSGVNVTSQAQLVRGVVGRDALLSVS
YTSTSLDQPVIKWQLKREGEKSVTVVQSIGTSIIGNLRPEYRDRILLYENGSLLIHNLQL
SDEGVYEVEISITDDSFTGEHSIELTVDVPVSKPFVQMIASSVLEYSEHFSIHCAHNEGT
KPIYSWMKGDNILTNDTRLLLSHDQKVLTIVRVQMADDDVYTCMVDNPISSTKSVPVRLS
VYRRSSLYIILSTGGIFLLITLVTVCACWKPTKKKRRSVPQRVPVYEEPSENGHDTVDVV
PKPSTLGRRSPMPLYVLNEDETLERLEECSGNLHVPPDMNCAPVYIHPPPAFNASDRPLW
SAPRRYPRSPAHSPMAHPPHQA
Download sequence
Identical sequences ENSGMOP00000012687 ENSGMOP00000012687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]