SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000012743 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000012743
Domain Number 1 Region: 127-331
Classification Level Classification E-value
Superfamily Rhomboid-like 3.66e-35
Family Rhomboid-like 0.0025
Further Details:      
 
Domain Number 2 Region: 12-66
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000898
Family Calmodulin-like 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000012743   Gene: ENSGMOG00000011915   Transcript: ENSGMOT00000013080
Sequence length 371
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4492:157084:176387:-1 gene:ENSGMOG00000011915 transcript:ENSGMOT00000013080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IHIIVFVCVSLQYDPESSGFISTERFRDLLATHGSELDPHKLEVLLALADNNADGKICYQ
DFVNLMSNKRSNSFRRAILQGGRQLKGSALREEVGLGLSQRLVRHVAYETLPREVDRKWY
FDSYTYCPPPWLILFITVAEVVVFMYYGFQLDRWVLQVSSPSYLKGPLPYHPQLRSQAWR
YLSYAFMHTGIEHLSLNMAMQLLVGVPLEMVHGALRITLIYVCGVLAGSLAVSVTDMTAP
VVGSSGGVYALVSAHLANVVMNWSGMKCQFKLFRMAMALVCMSVEFGRAVWLRFYPQAFP
PCPNPSFVAHLGGVAVGLTMGVVILQNYEQRLQEQSLFWIFFCVYTLFVLCAVFWNVFAY
SLLDVRLPPHP
Download sequence
Identical sequences ENSGMOP00000012743 ENSGMOP00000012743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]