SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000012836 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000012836
Domain Number 1 Region: 4-125
Classification Level Classification E-value
Superfamily Histone-fold 2.99e-48
Family Nucleosome core histones 0.00000409
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000012836   Gene: ENSGMOG00000012002   Transcript: ENSGMOT00000013177
Sequence length 130
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3134:47002:47432:-1 gene:ENSGMOG00000012002 transcript:ENSGMOT00000013177 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAHRVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK
TEKPAKKATY
Download sequence
Identical sequences ENSGMOP00000012836 ENSGMOP00000012836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]