SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000012858 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000012858
Domain Number 1 Region: 538-719
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.16e-51
Family DBL homology domain (DH-domain) 0.000000073
Further Details:      
 
Domain Number 2 Region: 724-859
Classification Level Classification E-value
Superfamily PH domain-like 1.21e-31
Family Pleckstrin-homology domain (PH domain) 0.00000234
Further Details:      
 
Domain Number 3 Region: 1009-1060
Classification Level Classification E-value
Superfamily SH3-domain 0.0000013
Family SH3-domain 0.0022
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000012858
Domain Number - Region: 236-305
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000137
Family Spectrin repeat 0.028
Further Details:      
 
Domain Number - Region: 57-138
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.000301
Family CRAL/TRIO domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000012858   Gene: ENSGMOG00000012012   Transcript: ENSGMOT00000013199
Sequence length 1077
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3099:4297:60041:-1 gene:ENSGMOG00000012012 transcript:ENSGMOT00000013199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GRSTNGNPLIVFPEFPEFSELEEEELQNVLKYLTSVPRVSGGGFVLLLDRRLDRWAAVKS
ALHRIQGLFPGGRVELVLVLRPSALLQRTLSDFLFKVNRDDFKMKVVMLSSVTELHAYID
PAQLTTELGGAREYDHQTWISHRTALEAFALMVRTTAQTLQAFGTELAETELPNDETTTX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLLGQL
DETERALEEFWERHRSKLEQCLQLRRFETRFREVRAQLDALCDRLSEFSEVSISPAHADH
VLRELIGHEEKAYVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXH
VMNELLETERAYVEELLCVLEGYAAEMENPAMAHLLPRGLLHKKDVLFGNMPQIYSFHKG
TFLKELEAYTDCPEMVGRCFLERMGELRIYEAYCQNKPRSESLWRQWSDCAFFQACQRRL
EHKLGLDSYLLKPVQRITKYQLLLKELLKVSRGSAGAEDLQEALSSILGILKDVNDSMHL
IAITGYEGNLSELGRLLMQGSFSVWTEHKKGHAKVKDLARFKPMQRHLFLHPRALLFCKR
REEAGXXXXXXXXXXXXXXXXMSVVGITENAKGDHKKFEIWCNSREEVFIVQAPSPEIKT
CWVNEIRKVLTEQLQACRXXXXXXXXXXXXXXXXXXXXXXXXXCNPKSQKKPEEKKVEPI
LTSDPSSGSSPKPRGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXWAKASLSVDASEEQEEEFSSGEEPVTSDPEDEDGPQSPATHTVTTDC
ERAGPQELSVKAGDLVQLIREGEAGQWFVKDLRSATEGWVFSILQALPSQSLTSSGF
Download sequence
Identical sequences ENSGMOP00000012858 ENSGMOP00000012858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]