SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000012983 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000012983
Domain Number 1 Region: 10-356
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.36e-133
Family Calpain large subunit, catalytic domain (domain II) 0.000000000312
Further Details:      
 
Domain Number 2 Region: 362-517
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 1.57e-52
Family Calpain large subunit, middle domain (domain III) 0.000000663
Further Details:      
 
Domain Number 3 Region: 524-703
Classification Level Classification E-value
Superfamily EF-hand 1.67e-47
Family Penta-EF-hand proteins 0.00000595
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000012983   Gene: ENSGMOG00000012126   Transcript: ENSGMOT00000013327
Sequence length 705
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3911:57300:86086:-1 gene:ENSGMOG00000012126 transcript:ENSGMOT00000013327 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAPIYATGIAAKLRSQWDRDDGLGQNHKAVKFLGQDYESLKANCAQRRGLFEDPLFPCA
PSSLGFDELGPRSAKTSGVRWMRPTEVCRNPKFIMDGATRTDICQGGLGDCWLLAAIASL
TLNDQLLHRVVPHGQSFDSGYVGIFHFQFWQFGEWVEVVIDDRLPVKEGKLLFVHSAEGT
EFWSALIEKAYAKLNGCYEALSGGSTSEGFEDFTGGVTEMYDLPKAPQDLFSIVGRAIER
GSLLGCSIDISSNKDMEAVTFKKLVKGHAYSVTGVNEVVYRGTPTKLVRIRNPWGEVEWT
GSWSDNSREWDSVDRNVRSKLQNRSEDGEFWMSFSDFLREFSRLEICNLTPDALQNCQLK
KWSTSLYQGEWRRGSTAGGCRNFPATYWINPQFKVALEHPDTAGQSGCSFLVALMQKDRR
KKRREGKDMETIGFAIYEXXXXFAGKSAVHLKRDYFLTHSSSARSELFINLREVSSRFSL
PPGEYIIVPSTFEPQKEGDFVLRVFSEKPTDSEELDDEVTAELPPETQLHESQIDQAFKN
LFRQLAGPDMEISVKELQTILNRIIGKHKDLKTDGFSKEACRSMINLMDTDGSGKLGLAE
FHVLWEKIKRYLTIFRQFDMDKSGTMNSYEMRRALDSAGIKLTNHLFQLIILRYTEEDLT
VDFDNFVTCLVRLETMFKTFNTMDTKREKCISLNFMQWISLTMFA
Download sequence
Identical sequences ENSGMOP00000012983 ENSGMOP00000012983

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]