SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000013026 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000013026
Domain Number 1 Region: 21-154
Classification Level Classification E-value
Superfamily EF-hand 1.66e-26
Family Calmodulin-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000013026   Gene: ENSGMOG00000012164   Transcript: ENSGMOT00000013373
Sequence length 212
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3741:20929:62510:-1 gene:ENSGMOG00000012164 transcript:ENSGMOT00000013373 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPMHPVTSTLMYRGICTIPDILSYSAPVNLPEDEVEEIREAFKVFDRDGNGFISKQELGV
AMRSLGYMPNEVELEVIIQRLDMDGDGQVDFEEFVALLGPKLSATMPDKFYGADFDSVFW
KCDMQKLTVDELKSLLYDTFCDHLTMKDIENIIMTEESHLNSPECQVDIDTSPTQQVKHT
CVRKSLICAFAIAFIISVMLIAANQMLRRGMK
Download sequence
Identical sequences ENSGMOP00000013026 ENSGMOP00000013026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]