SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000013055 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGMOP00000013055
Domain Number - Region: 6-117
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00157
Family LacY-like proton/sugar symporter 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000013055   Gene: ENSGMOG00000012191   Transcript: ENSGMOT00000013402
Sequence length 229
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2757:39577:41194:-1 gene:ENSGMOG00000012191 transcript:ENSGMOT00000013402 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AIMASPVLLVCSMASMEGIHVWSYVGWQDPAIVGLFLLCVLIGCAMNFTTLHCTYINSAI
TTSFVGVVKSIATITVGMLAFSDVQPTQLFVAGVVVNTLGSVIYCCVKYAETRHKSAYDD
LEETQEAGSPTGPPYQEKGLSNGSGPGPGPAENGGVGWTGKGETGVALPEMTEAEITEMQ
REHLQKERPVSPPAGDSCAGVMRSVKQMQFLRKEPGLIDNMEQQSPLCP
Download sequence
Identical sequences ENSGMOP00000013055 ENSGMOP00000013055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]