SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000013060 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000013060
Domain Number 1 Region: 112-701
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 8.71e-185
Family Myeloperoxidase-like 0.0000000000433
Further Details:      
 
Domain Number 2 Region: 732-854
Classification Level Classification E-value
Superfamily TNF-like 1.9e-28
Family TNF-like 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000013060   Gene: ENSGMOG00000012193   Transcript: ENSGMOT00000013407
Sequence length 856
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2877:280495:289563:1 gene:ENSGMOG00000012193 transcript:ENSGMOT00000013407 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RVFIENIVKEAMAKVDQDYEYSRRESLSRVRRSRVTPSDILRLLKQPSGLSRSAVRASDY
MDHAIQLLQKRSLQEHRVHKRSINATDLIMEEDLKTIADITGCSARLRSPSCPTWRFRTA
NSECNNKKNSRLGAANIPFTRWLPAKYQDGFSLPAGWDPKIKKNNHLLPLVRKVSNQIFD
ARTNALTSDPLYTHLVTIFGQWTDHDLTFTPHIPVIRSFNDGIDCAKTCDRKEPCFPMVF
PENDRRLKNSDSPKCMPFFRSAAACGSGNTGFLFGGRAVRQQLNTLTAYIDSGQVYGSDV
SLATKLRDLSSDLGLLRVNAMYNDSGRELLPFTSMTNNMCSSRAAITGETDAQEVPCFIA
GDERTNENIALTSLHTLLMREHNRLARALAKLNPHWSGERLYQEARKIMGGYFQVITFRD
YLRHIVGPSVIAKRLSTYPGYSEAVDPSISNVFATAAYRFAHLAIQPVIFRLDENFKEHS
EFGNVMLHKAFFAPWRIVFEGGVDPILRGLVGQRAKLNTQDNMMNTDLRDRLFKFLDDLA
LDLAALNLQRGRDHGLPGYNDWRKFCKLSQPRDVDELAAVLNNTELAEALIELYGTPDNI
DVFLGGVAEPFVPGGRVGDLFACLISVQFQNIRQGDRLWWENDGVFTGTQRKSMMSASLA
RIMCDNTGIVEVPERPFEYQPRSGYTKCEKIPSFDLSPWKENXXXXXXXXXXXGPPGPQG
PQGPPGPAGSTPAVGFSVRLGESYPKANVPIVFSSVIYNGQDAYDVKKGIFTCVQPGVYE
FQFHCTIHGKSGSVDLKRNKELILHSYTTKQSGYLTASGSTLLSLKKGDLVYLIANSGGN
GLNKDSYFSGHLLFAV
Download sequence
Identical sequences ENSGMOP00000013060 ENSGMOP00000013060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]