SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000013091 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000013091
Domain Number 1 Region: 92-196
Classification Level Classification E-value
Superfamily Immunoglobulin 7.88e-16
Family V set domains (antibody variable domain-like) 0.0062
Further Details:      
 
Domain Number 2 Region: 12-77
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000295
Family V set domains (antibody variable domain-like) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000013091   Gene: ENSGMOG00000012226   Transcript: ENSGMOT00000013439
Sequence length 222
Comment pep:novel contig::contig655622:151:1192:1 gene:ENSGMOG00000012226 transcript:ENSGMOT00000013439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IMLPFIVKKEKKIHYLYWYKQSPGYFPQMVASKSYGSITMKPHFDLRFTMEEGESHPSNV
TEGDEANYFCSQSSLTPGNCTFLSVKGRIFSQTVVQQPVSASAQLGDPVALQCFITSERT
DHSNQCQGEPSVYWFRSGSGPSHPAAIYMNGTTVVNVSCVYTLPKNNVDSSDAGTYYCAL
AACGEAVFGSGTTLDINPNHHLVILVHRILLACCLLVILILI
Download sequence
Identical sequences ENSGMOP00000013091 ENSGMOP00000013091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]