SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000013121 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000013121
Domain Number 1 Region: 206-282
Classification Level Classification E-value
Superfamily GAS2 domain-like 9.15e-26
Family GAS2 domain 0.00019
Further Details:      
 
Domain Number 2 Region: 18-176
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.72e-23
Family Calponin-homology domain, CH-domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000013121   Gene: ENSGMOG00000012260   Transcript: ENSGMOT00000013470
Sequence length 312
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2877:613547:630895:-1 gene:ENSGMOG00000012260 transcript:ENSGMOT00000013470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADQSNIQSAASKSIRPFKSSEEYLYAMKEDLAEWLNTLYDLDLSADTFADGLDGGCALC
RHANNVNRAALDFQRERPEAARPLRMPSKDVVFQSRNVVSGSFVARDNVSNFITWCRQEL
WIKDVLMFETNDLVERCNEKNFVLCLLEVARGAKFGMLAPMLIQLEEEIEEEIRDQKEVP
KSLSLEDETDEAQFVWQQKRVLLDMRNLDELVREILGRCSCPGQFPMTKVSEGKYKVGDS
SALIFIRVLRTHVMVRVGGGWDTLEHYLDKHDPCRCAAFAHRYHQAKASNQGQGGHSKSS
SAHSSRSTSPGP
Download sequence
Identical sequences ENSGMOP00000013121 ENSGMOP00000013121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]