SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000013126 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000013126
Domain Number 1 Region: 49-521
Classification Level Classification E-value
Superfamily Sema domain 2.09e-145
Family Sema domain 0.00000000122
Further Details:      
 
Domain Number 2 Region: 523-573
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000802
Family Plexin repeat 0.0013
Further Details:      
 
Domain Number 3 Region: 578-644
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000226
Family I set domains 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000013126   Gene: ENSGMOG00000012258   Transcript: ENSGMOT00000013475
Sequence length 764
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3660:1135325:1143257:-1 gene:ENSGMOG00000012258 transcript:ENSGMOT00000013475 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTESGGNSEFYFNSSKRNMDLLLSLRLLWLMPLAWTLEGAPPQGISRKTIPYHKDHGQLF
HEAGVWNYSTMLLREELGLLLLGACDTIYALDLDNISDKKAVKWEVPEAKQTECKNKGKD
AEIHCKNYIRVLHTLSDGRMYVCGTNAFDPECDLMSYKDGNLILEKEVSIGDGKGKCPFD
PFQTYASIMVDDNLYSATSMNFLGSEPVVMRSSSISIRTEFKSSWLNEPNFISMAQVPES
KDNSEGDDDKVYLFFNEAALEYDSYSKLMVSRVARVCKGDLGGQRTLQKKWTSFLKARLD
CPVLESKLPFTIQDTFLLCEPQVSWKECLFYAVFTQQPHSPALTAVCSYRVADISAVFSK
GKYKNPLPVETSYVKWVMYSGDVPSPRPGACIDNEARKQGINQTLDLPDRTLQFVKDRPL
MDQAVPPIGVGPLLVQRGAAFSRIVVTRVMAFDDQKYHVAFIGTVESGTLVKAVNYDGKM
FIIEEVQLFPSREPIKVLKLSEAKGYLYAGSASGAVQMPLATCGRSLSCMDCVLARDPYC
GWDQTTSKCIAHLHGQSLSELIQSVKNGDASLCPAAGTVTPVNESIWLRSNLRLPCRPPS
NLAAVSWQRDTIPLAPSDHYQVLPDGLLISNASALHAGHYRCLSLERSTAGDYTSVVADY
QVGLVAGEWPLSPEARQDGPLVAGLQVTVGILVVLLAGLLTWNLLKGHLPLPCKRKTTGV
ESLDTAQPSLPLEAGKNHSGGDWRNGENVVPNGPKQFIGDESEI
Download sequence
Identical sequences ENSGMOP00000013126 ENSGMOP00000013126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]