SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000013131 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000013131
Domain Number 1 Region: 17-147
Classification Level Classification E-value
Superfamily PH domain-like 1.04e-19
Family Pleckstrin-homology domain (PH domain) 0.00039
Further Details:      
 
Domain Number 2 Region: 172-255
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000177
Family SH2 domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000013131   Gene: ENSGMOG00000012268   Transcript: ENSGMOT00000013480
Sequence length 361
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3660:1146363:1150100:-1 gene:ENSGMOG00000012268 transcript:ENSGMOT00000013480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVAPVKQRSVTGGTRAQLPPCYYEGYLEKRGPKEKASRRLWSSLCGNAMFFFNNAKDTH
YVERLDLGGFVSLRDDCSRDRNLEAARLILRMKDGETKITAPNLESRELWKGFLYSVVDL
NVPACLTLLPGQLQMLKEVVDKERSRRRARTPTRAPPSPLSVPLVGEIPARPVSRTEAEV
LLERHPDCGNMLLRPGRDGCSLAVTTRQDLNGSVFRHYRVTQREQGGYIIDVENPIPCSS
LHEVIDALVEKTAGTLQPFLLEPYEENITYVSSNDENGERMLHTAPSSPLPRAPALPPKQ
ADRLSSKPLPRPAPDRRILAAAVPSSPTNPMRRLILSPSPLAQTLNEELKLKLEKRRASQ
E
Download sequence
Identical sequences ENSGMOP00000013131 ENSGMOP00000013131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]