SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000013146 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000013146
Domain Number 1 Region: 60-520
Classification Level Classification E-value
Superfamily Sema domain 1.1e-134
Family Sema domain 0.000000318
Further Details:      
 
Domain Number 2 Region: 516-564
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000075
Family Plexin repeat 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000013146   Gene: ENSGMOG00000012280   Transcript: ENSGMOT00000013495
Sequence length 609
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3660:1193886:1236787:-1 gene:ENSGMOG00000012280 transcript:ENSGMOT00000013495 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCWAAMATMAPPLTFLLLLLQVADGSFPEEPSPLSYAPLEVVRRYPVFVGRAHPSALRQE
MHIQTVLQVNRTLYIGARDDLYRVELDNMVGDEMFYSKXXXXXXXXXXXXXXQMKDNEGE
CRNYIKVLLSHHDGLFVCGTNAFNPLCANYTRDSLEMAGESVSGMARCPYDPRHANVAVF
AEGSLFTGTVTDFLAIDAVIYRSLGDSPALRTVKHDSKWFREPFFVSAVEWGPHIYFFFR
EMAMEFHHLEKVMVSRVARVCKTDLGGSQRVLEKQWTSYLKARLNCSVPGDSHFYFNLLH
ATSGVLHLQGRAVVLGLFSTPPNSIPGSAVCVFDMQQLAHVFEGRFKEQKSPESIWTPVP
DELVPRPRRPGGCAVEGSRFSSSNSLPDEVLNFVKTHPLMDETVPLLGHRPWVVRTMGRY
QLTTMVVDTEAGPQRNRTVLFLGSTRGTVLKFLMVPSGEPVAHSSVFLEEVEGFNPEKCG
EDTPQARQLLSLLLDRSSHTLLLAFPSCLVRVPTSRCHLHARCMKSCLASRDPYCGWTRG
STCSFLRPGTRLPFQQDVEYGNTTSHLGDCDGLLQQSLLIEPESLVSLNLLVASAVSAFT
IGAALSGLA
Download sequence
Identical sequences ENSGMOP00000013146 ENSGMOP00000013146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]