SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000013162 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000013162
Domain Number 1 Region: 67-228
Classification Level Classification E-value
Superfamily EF-hand 3.12e-27
Family Calmodulin-like 0.025
Further Details:      
 
Domain Number 2 Region: 197-297
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000273
Family Calmodulin-like 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000013162   Gene: ENSGMOG00000012302   Transcript: ENSGMOT00000013513
Sequence length 324
Comment pep:novel genescaffold:gadMor1:GeneScaffold_299:221377:227777:-1 gene:ENSGMOG00000012302 transcript:ENSGMOT00000013513 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLPMDSYRLVYAVLLCILAVHCKPTLRKERVHHDQAELSKRPHEDNNSFKYDHEAFLGKE
DATTFDQLTPEESKDRLGKIVDRIDGDGDGYITTSELKAWIRRVQKRYVYENVAKVWSDY
DLNKDDRVSWEEYKQATYGYYLSNPEEFEDETDQFSFRKMMPRDERRFHAADVNGDQTSD
REEFTSFLHPEEFDHMKDIVVQETLEDIDRNGDGHVDEDEYIADMFAHEEGGPEPDWVKT
ERDQFSDFRDLNKDGKMDQEEIRQWILPKDYDHAQAEARHLVYESDLDKDKMLTKDEVLE
NWNMFVGSQATNYGEDLTRNHDEF
Download sequence
Identical sequences ENSGMOP00000013162 ENSGMOP00000013162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]