SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000013258 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000013258
Domain Number 1 Region: 174-258
Classification Level Classification E-value
Superfamily Second domain of FERM 7.98e-26
Family Second domain of FERM 0.0000135
Further Details:      
 
Domain Number 2 Region: 93-173
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.72e-25
Family First domain of FERM 0.0000896
Further Details:      
 
Domain Number 3 Region: 343-420
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000111
Family Third domain of FERM 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000013258
Domain Number - Region: 869-907
Classification Level Classification E-value
Superfamily Dodecin-like 0.0876
Family Dodecin-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000013258   Gene: ENSGMOG00000012383   Transcript: ENSGMOT00000013610
Sequence length 921
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2105:506140:537431:-1 gene:ENSGMOG00000012383 transcript:ENSGMOT00000013610 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTESGADSEPKTQQEKSKEADKEKEKTAKAAAAASAEEPGSPRVQLPVAAGHSTPASLL
SQDSHEEDQASNRSSTSHLSRSPLRGAKKLKNMQCKVTLLDGTDYNITVEKRAKGHILLD
KICDHLNLLEKDYFGITYRDVENQKNWIDPTKEMKKQIRTGPWNFAFNVKFYPPDPALLS
EDITRYFLCLQLRDDVVSGRLPCSFATHTMLGSFTVQSELGDYDPEEQGSDYISELRFAP
NQTKELEEKVMEMHKSYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFEQFESTIGFKLPNHRAAKRLW
KVCVEHHTFFRLVSPEAPPKKFLGLGSKFRYSGRTQAQTRRASSQIIRPAPLFERSASKR
YNMSRSLDGAPIMENHETLMKDHTADRVAKADIITTVTPEKKAEEEREEREDDQADATAT
AEATPTTPLRHDTKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGGGTLFSFSLHLPDVMSFLDED
GYISFPDLAELRFLPECAHHFLPIXXXXXXXXXXXXXXXXXXXXXXXXXSKVGFSRFCFL
LSMGIGSVCLTKQTDSEQTDFAFDGETTATESEAEDDYEMRTQDTDASADLGKHQTNISE
LKRSFLETGERAPETEWEKRLSSSPARSLRADEPPMIEPLLLPQDVSLKGVPSPTRAKAS
WVSEVVKTEVEFTSMSAKSGVGEPAPKDSPVVHTETKTTTYESAEGDTNGDVDPGVLLSA
QTITSETSSTTTTTHITKMVKGGISETRIEKRIVITGDTDIDHDEALAQAIKEAKEQHPD
MSVTKVVVHKETEITPDEGED
Download sequence
Identical sequences ENSGMOP00000013258 ENSGMOP00000013258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]