SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000013259 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000013259
Domain Number 1 Region: 633-817
Classification Level Classification E-value
Superfamily Fibronectin type III 3.9e-26
Family Fibronectin type III 0.0000737
Further Details:      
 
Domain Number 2 Region: 503-608
Classification Level Classification E-value
Superfamily Fibronectin type III 2.31e-24
Family Fibronectin type III 0.00000856
Further Details:      
 
Domain Number 3 Region: 196-292
Classification Level Classification E-value
Superfamily Immunoglobulin 8.89e-23
Family I set domains 0.0072
Further Details:      
 
Domain Number 4 Region: 403-493
Classification Level Classification E-value
Superfamily Immunoglobulin 6.71e-22
Family I set domains 0.017
Further Details:      
 
Domain Number 5 Region: 296-395
Classification Level Classification E-value
Superfamily Immunoglobulin 2.7e-20
Family I set domains 0.01
Further Details:      
 
Domain Number 6 Region: 9-108
Classification Level Classification E-value
Superfamily Immunoglobulin 7.92e-20
Family I set domains 0.056
Further Details:      
 
Domain Number 7 Region: 114-206
Classification Level Classification E-value
Superfamily Immunoglobulin 4.39e-17
Family I set domains 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000013259   Gene: ENSGMOG00000012385   Transcript: ENSGMOT00000013611
Sequence length 1291
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3787:16834:136286:-1 gene:ENSGMOG00000012385 transcript:ENSGMOT00000013611 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRLRQEDFAPRIAEHPSDLIVSKGEPATLNCKAEGRPAPTVEWYKDGERVETDRDSPRSQ
RMLLPSGSLFFLRIVHGRRSKPDDGSYVCVARNYLGEARSHNASLEVALLRDDFRQNPQD
LVVVVGEPASLECQPPRGHPEPTVYWKKDKGRLDLKDDRLAXXXXXXXXXXXKKTDAGTY
VCVATNMVGEKESETAQLSVFERPVFVQRPVNQVVLVEESVEFRCQVQGDPPPTVRWRKE
DVDLSRGRYDIRSEKEDSLLRIKRASASDQGTFTCTAENRVGKVEASAYLTIRXXXXXAP
QFVVRPRDQIVTQGRSAAFPCETKGKPQPTVFWQREGSQDLLFPNQPTQGDSRVSVSLSG
EMTIRSVQRADAGYYTCQALTVAGSILAKALLEVADASKDRPPPIIRQGPSNQTQAVGGA
AVLRCLASGDPEPTITWLKDRASLLGKDPRMALLDHGSLQIQDTQLSDAGLFTCVATSST
GETSWSAYLDVRESGDLVDFMSHNATALPGPPSKPEVTDVTKSSISLSWEPGPEAGTPVT
SYVIEAFGQSVSNSWTTLADHVRTTQFTVRDLRPNTVYLFIIRAVNTQGLGDPSAMSEPV
RTQDIRPTVQGVDHRRVQKELGEVLVSLHNPVVLSSTSVHITWTVENPSQFIQGYHVLFR
QTSGLPSPGSWAVEDLTVAAERDLTLAALKKGIVYEIKVRPYFNEFQGADSESMTARTLE
EAPSAPPQQVTLQPVGSSNSTSVTVAWDTPPQDQQNGIIQEYKIWCAANETAFSVNRSVD
ATVRSVVVGGLQAGVQYWVEVAASTSVGVGVRSKPQPIILGSTELRDPSPGPEGGSSLSE
VVKQPAFIAGLGGAVWIVLMGFSAWLYWRRKKRKGISNYAVQSFTFTRAXXXXXXXXXXX
XXXXRPGLLKAGDQGLPWLADSWPSTSLPANGALGSPKSSANYGRGDVLPSAAGEKTGTM
LSDGAIYSSIDFMGKAGYSSPSRAALPTPYATTQILQSNSFHELAVDRPDPRWKASLQAQ
QEMASLGYSLTDRRPCSGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPPLGGKSTAG
GKRKKARAGSKTSKPGGSCWANAPLPPPPMHPLPGXXXXXXXXXXXXXXXYDSDGWAPPL
NVQTYLHHDMDHDGEQEHGPAPPVKGRTASPMTASFGQSSSTSLSSAHHEEMQSILQAHL
DELTRAYQYEVAKQTWGHMKGSPSLTKSRIGPRDYMSSTLGSDLGTTLLSEEDEEDDEED
EEEEDRYAAVSKALCGFDYTPAHSMEGLEST
Download sequence
Identical sequences ENSGMOP00000013259 ENSGMOP00000013259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]