SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000013279 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000013279
Domain Number 1 Region: 620-687,890-1135
Classification Level Classification E-value
Superfamily Ras GEF 2.62e-67
Family Ras GEF 0.00036
Further Details:      
 
Domain Number 2 Region: 222-444
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.01e-38
Family DBL homology domain (DH-domain) 0.00031
Further Details:      
 
Domain Number 3 Region: 24-130
Classification Level Classification E-value
Superfamily PH domain-like 1.05e-17
Family Pleckstrin-homology domain (PH domain) 0.007
Further Details:      
 
Domain Number 4 Region: 432-588
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000591
Family Pleckstrin-homology domain (PH domain) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000013279   Gene: ENSGMOG00000012397   Transcript: ENSGMOT00000013632
Sequence length 1137
Comment pep:novel genescaffold:gadMor1:GeneScaffold_52:186362:220309:1 gene:ENSGMOG00000012397 transcript:ENSGMOT00000013632 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKSVRYNEGHALYLSVVARKEGSKRGVLSKKTTENSRWSDKFFALYQNLLFYFENDQST
RPSGIYLLEGCTCERSPAPKQGSRGTAAALPPHYFLVVFGHDGQKPLELRAEEETECTDW
VECIQQASYSDVMVEREVLMQKYIHLVQIMEMEKVAANQLRTQLEDQETEIERLKXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXVQSFMRGWLCRRKWKLIVQDYISSPHAESMRK
RNHIVFNMVEAETEYVHQLSVLVNCFLRPLRMAASSKKPPISHDDVSSIFLNSETIMFLH
EIFHGLQARIANWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFDKLLK
QYEANAACEGRMLETYLTYPMFQIPRYIITLHELLAHTPHEHVERKSLEFAKSKLEELSN
RMMHDEVSDTENIRKNLAIERMIVEGCDFLLDTSQTFVRQGSLIQLPSSSERGVLSKVRL
GSLSLRKEGERQCFLFTKHLLICTRSSGGKLHLLKQGGTLSLIECTLIEEVDASDEDFNA
AGQGSNHLEFKVVVEPTEGPSFSAVLLAPSRQEKAAWTSDISQCIDNIRCNGLMTSVFEE
NSKVSVPHMIKSDVRLHKDDVDICFSKTLNSCKVPQIRYASVERLLERLTDLRFLSIDFL
NTFLHTYRIFTSAAVVIDKLADIYKKPFTSIPVSGQRLSFYVLIFSYPLPHVFHFRSSAP
SSNHCRHHLRVQYHSSDRLSITSISPDYSLKITQLALDQSNSXXXXDVSGELPRLDAFCG
KLRRSIRRAVLETVSLDKFIPESPATSESGDLSPCRSPSASRHMRYRQTGXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDFDMN
SDLKSGVVSLLDEVLRDPDLLPQERKATTNILSALSQDEQDESQLKIEDILQMAESPKAE
CLESLSAMELAEQITLLDHIVFRGIPYEEFLGQGWMKVDKTERTPYIMKTSQHFNNMSNL
VASQIMANADVGSRAGAIEKWLAVADICRCLNNYNGVLEITSALNRTAIYRLKKTWAKVC
RQVGASPTLSEIRQFQQAPYRIEHQTKVTQFLLDKSLVMDEDTLYELSLKMEPRVAP
Download sequence
Identical sequences ENSGMOP00000013279 ENSGMOP00000013279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]