SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000013329 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000013329
Domain Number 1 Region: 180-392
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.64e-44
Family DBL homology domain (DH-domain) 0.000000576
Further Details:      
 
Domain Number 2 Region: 2-227
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.49e-37
Family Calponin-homology domain, CH-domain 0.0035
Further Details:      
 
Domain Number 3 Region: 378-539
Classification Level Classification E-value
Superfamily PH domain-like 1.17e-32
Family Pleckstrin-homology domain (PH domain) 0.0053
Further Details:      
 
Domain Number 4 Region: 627-731
Classification Level Classification E-value
Superfamily SH2 domain 8.51e-21
Family SH2 domain 0.0014
Further Details:      
 
Domain Number 5 Region: 777-834
Classification Level Classification E-value
Superfamily SH3-domain 4.59e-20
Family SH3-domain 0.00078
Further Details:      
 
Domain Number 6 Region: 583-650
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000114
Family SH3-domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000013329   Gene: ENSGMOG00000012445   Transcript: ENSGMOT00000013683
Sequence length 835
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2105:1227305:1282649:-1 gene:ENSGMOG00000012445 transcript:ENSGMOT00000013683 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEYWRQCALWLISCKVLPVNHRVTADTAQVFDLAQTLRDGVLLCQLLNNLKPQTINLKEI
NLRPQMSQFMCLKNIRTFLTSCCEAFGMKKCDLFEAFDLFDVRDFGKVMDSLSKISYTTI
AQQGGFKPFPTEVSLNEEDIYNNLEDLLDENTPEDEEEQYAAVYRLEEDYDGGDIYEDLM
RTEQQAPXQPEQDVRSCCLSEIKQTEEKYTETLSIEKYFLNPLKKFFSAAEIDKVFLNIP
TWKVHKSLMVDVQDSILNRNSLNLYQIFITYKERLLIYGIYCSQVEIAIAVLDLICKEKE
DVRLKLEECAKRANNGKFTLRDLLVVPMQRVLKYHLLLQELVKHTHDTADKSNLRMALDA
MKDLAQYVNEVKRDNETLREIDQYQRSIENLNQPLINYGRPKGDGEVRIVSNFDKRKQDR
HIFLFDLAVIVCKRRGDNYDLKDVLYLNFYKITNNPTSDREGKKWCYGFYLTHNQGHTGF
ELFFKTMELKKKWLDQFEMAVSNIRPDNANSNSHQFKMHTFERITSCSFCHLLLRGIFNQ
GYLCNKCGLGAHKECLGRLVMCGRPGEXXXXXXXXXXXXXXXXXXGLPRMLVIRDYCGVP
QPEQGSPLCMQAGDVVELISANPHISWWQGKILGTGLTGFFPSNSVRPCPCVPKPVDYSA
QPWFAGPMERSQAEVELLNCENSTFLVRHRTKESAEYAISIKFNDEVKHIKILTKEGWFY
IAETRLFKSLLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFSPRVV
NTAVARYDFSSRDTRELSLAEGDVVKIYFKMSNGWWRGDVDGRVGWFPSTYVEEE
Download sequence
Identical sequences ENSGMOP00000013329 ENSGMOP00000013329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]