SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000013366 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000013366
Domain Number 1 Region: 1-185
Classification Level Classification E-value
Superfamily EF-hand 1.85e-29
Family Calmodulin-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000013366   Gene: ENSGMOG00000012487   Transcript: ENSGMOT00000013721
Sequence length 187
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2105:1732520:1737974:1 gene:ENSGMOG00000012487 transcript:ENSGMOT00000013721 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNKQTIFSAQQLDAYQDCTYFTRKEILRLFSRYRDLAPQLVPLDYTHQPDVKLPYELIG
SMPELKDNPFRQRIAEVFSEDGEGNMTLDDFLDMFSVLSEMAPRDLKAYYAFKIYDFNND
DFICKLDLVKTLNKLTRNELTEDEVRMVCEKVMDEADMDNDGRLSLEDFQHVIVRAPEFL
STFHIRI
Download sequence
Identical sequences ENSGMOP00000013366 ENSGMOP00000013366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]