SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000013393 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000013393
Domain Number 1 Region: 462-610
Classification Level Classification E-value
Superfamily EF-hand 2.92e-48
Family Osteonectin 0.00000139
Further Details:      
 
Domain Number 2 Region: 403-458
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000873
Family Ovomucoid domain III-like 0.0002
Further Details:      
 
Domain Number 3 Region: 378-402
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000711
Family Follistatin (FS) module N-terminal domain, FS-N 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000013393   Gene: ENSGMOG00000012509   Transcript: ENSGMOT00000013748
Sequence length 612
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4112:307440:314577:1 gene:ENSGMOG00000012509 transcript:ENSGMOT00000013748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGHLVCICLLATTFALSVKSKPHNKHHALSKSSHTAKHKDVLPEEADAEQLLPTFVSLE
AGSGEQEDQELGANANANANANTQEEGVLQATQGGEKSTAVLLSEEELVDLLNKEMMEEQ
TGCGEEVKGGGMDRVKADQDTENPQRKGKNGKPKMEEEKEREANNGNIYMLEEEEAKEDD
EQEAKIHGRRGDKGKAGSAVDGADGSTDSEILADLDYASDADLSQPLLSTTPEGTSKEEG
SERGAHKLIPTILKIVDALEREVMADQTRSSGEQSVKEEETKRMARTQTGGPAAMEEDKD
SNNTGSVPKGKKGKSTRQRARKHAVGTRLAVVRNRKHRGNADSTDPKNKRRRTGKWAPLV
GMNPVQIRSTAELYPSTNPCMDFRCKRGKACMLDADLKPACVCQEPTKCPASVNEFDHVC
GTNNKTYDTACALFATKCNLEGTKRGHKLHLDYTGPCKLLAPCLDSELVQFPLRMRDWLK
NVLLQLYSHDSMSPGFLTSKQRIKVKKIHENERQLHAGDHPLDLLAQDFEKNYNLYIYPV
HWQFAQMDKHPSDRLLSHSELAPLRVPLVPMEHCTSRFFQECDGDQDKQVSFREWAHCFG
IKEEDMDVNLLF
Download sequence
Identical sequences ENSGMOP00000013393 ENSGMOP00000013393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]