SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000013397 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000013397
Domain Number 1 Region: 829-1107
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.7e-72
Family Protein kinases, catalytic subunit 0.00000641
Further Details:      
 
Domain Number 2 Region: 519-812
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.97e-48
Family Protein kinases, catalytic subunit 0.000065
Further Details:      
 
Domain Number 3 Region: 358-473
Classification Level Classification E-value
Superfamily SH2 domain 9.66e-16
Family SH2 domain 0.0021
Further Details:      
 
Domain Number 4 Region: 269-373
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000172
Family Third domain of FERM 0.011
Further Details:      
 
Domain Number 5 Region: 143-259
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000324
Family Second domain of FERM 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000013397   Gene: ENSGMOG00000012519   Transcript: ENSGMOT00000013752
Sequence length 1120
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2098:142642:176599:1 gene:ENSGMOG00000012519 transcript:ENSGMOT00000013752 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACISAMDMPSPVRLPVHLNGTAHLQPGATVTAVALRLHLYHSGPLGERDGPLTFPPGHY
LAEELCIQAAKTCGVSPLYSSLFGLFCEQEALWFPPSHVFQLDGAASKDISFKIRFYFPN
WYCGGGSRAYRYGLSKGSGSAVLDDSVMAYLFSQWKSDFVSGVVPVSCSHEAQEECLGLA
VLDMMRTSKERHLSPLDIYHTLSYKSFLPKNMRSQIQGCNFVTRKRIRFRFKRFIQQFSQ
CRASARDLKLKYLISLESLEAAFYTETFQLQEPSSRLTILVAADSGIRWCREKSKDTEQE
MQILCDFPDVTDISIKLAIKEGGGENRVVTINKNDGKSRDLEFPNLAEALSFVSLIDGYC
RLTTDAHHYLCREVAPPRLMEAIHSHCHGPISMDFAINRLHKAGNKSGLYILRHSPKDFD
KYYLTFPVVMNDVVEYKHCQISRSCGGEFNLNGTKRTFMGLQELLACYHKETVRSDGVVF
HFNRGCPPKAKAEKSCLLVCRRDKGLDVAASPSPHRHNISQMVFHKIKKEDLQFMESLGQ
GTFTKIFKGVRKELGDYGLLHQTEVVMKVLDHAHRAYSESFFEAASMMSQLSHKHLVLNY
GVCVCAGEDNIMVQEYVKFGSLDTYLKKNKNSVNILWKLEVAKQLAWAMHFLEEKNLAHG
NVCAKNVLLIREEDRRTGNPPFIKLSDPGIGVTVLPKEILTERIPWMAPECVEEPGSLSL
AGDKWSYGTTLWEICSGGEKPLAALDHTKKHMFYAERLQLPAPKWTELANLISSCMDYEP
SFRPTFRAVIRDLHSLFTPDYELIVESDIMPNKTLSSGWVTGGFESQEPAQFEERHLIFL
QQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTAEHIREFEREIEILKSLQHENIVK
YEGVCYSAGRRNLRLIMEYLPYGSLRDYLIKNKERIDHSKLVHYTAQICKGMEYLSNKRY
IHRDLATRNILVESENQVKIGDFGLTKVLPQDKEYYMVKEPGESPIFWYAPESLTENRFS
VASDVWSFGVVLYELFTHSDKNCSPPAMFMAMMGNDKQGQLIVYHLIELLKSGSRLPQPL
GCPTEIHDMMQECWDNEPAMRPSFKELALGVDLFRDSRGF
Download sequence
Identical sequences ENSGMOP00000013397 ENSGMOP00000013397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]