SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000013407 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000013407
Domain Number 1 Region: 47-285
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.49e-53
Family DBL homology domain (DH-domain) 0.0000264
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000013407   Gene: ENSGMOG00000012527   Transcript: ENSGMOT00000013762
Sequence length 876
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2105:2060406:2075232:1 gene:ENSGMOG00000012527 transcript:ENSGMOT00000013762 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDELDSLRSRFLHEDTLSLASSSTELSNIEYASLEGELEADAQDLEGDSWSLEVDQDYLK
PMSKESIKRQDVIYELIQTESHHVRTLKILLCVYRKELIESALVDEARLKRLFYRLDGLL
ELHTALLQGLKQRRLESMVEGSPRNYQIRQLADILTAQFSGELGERMKDFYGAFCYYHRD
AVTFYKDLLQSNKKFQAHMRKVGQLSIVRRLGIPECFLLVTQRITKYPVLVERIIQNTEA
ETEEQSALAHALTQIRDCISHVDGQVSDFENAARLRDIAQRLEPKSQCLLKDTPFSREDL
TEASRTLQNEATFTIKESSGKLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXRDMLIEKNLQEKLQIFAFFTENLTGVETPQKRLLLRGDASDLQQ
GETLIMGAIKDVEGLQDLLLARIRDPNQAADDSQGPPLLLRRAQTFGGXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVP
PLVPPRRHSMSPKPVVVVPLQLVSTTNQPHKEGGVQQQIPTKLAVLSKAKSTKSSKSIDM
SQVVPIKVTGKEGGSLRFTRPTPPINVKPSPSFSTH
Download sequence
Identical sequences ENSGMOP00000013407 ENSGMOP00000013407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]