SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000013418 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000013418
Domain Number 1 Region: 132-459
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1.83e-69
Family NAD kinase-like 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000013418   Gene: ENSGMOG00000012538   Transcript: ENSGMOT00000013773
Sequence length 473
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2105:2178515:2193696:1 gene:ENSGMOG00000012538 transcript:ENSGMOT00000013773 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGRVDKIGVTMSGHSGQGPQPSRTSKHRERRSKSPRRRREGKRSQPRGGNSQSLQETGYR
RLPGHREQSAQTSTATEPADDGSPKRRAHFLHGPYPATHFGPKACILPNPTSVMHIQDPA
SQRLTWTNPPSNVLVIRKIHDESLVEPFKELCRYLVEEKQLMVYVERRVVEDGTLKDDEL
FGSICNQLCTFREGFDDISDCIDLIICLGGDGTLLYASSLFQGSVPPVMAFHLGSLGFLT
PFKFESYKTEVAKVLEGNAAITLRSRLKVKVVKXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXVLNEVVVDRGPSSYLSNVDLYLNGRLITSVQGDGVIVSTPTGSTAYAAAAGAS
MIHPNVPAXXXXXXXXXXXXXXXXXXXXXXXXXITLSPDARNTAWVSFDGRKRQEIQHGD
CIKITASCYPVPSICCHDLVYDWFESLAQCLHWNVRKRQAGLAQPSDSSDTEN
Download sequence
Identical sequences ENSGMOP00000013418 ENSGMOP00000013418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]