SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000013425 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000013425
Domain Number 1 Region: 569-758
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.54e-52
Family DBL homology domain (DH-domain) 0.0000000206
Further Details:      
 
Domain Number 2 Region: 763-898
Classification Level Classification E-value
Superfamily PH domain-like 1.72e-37
Family Pleckstrin-homology domain (PH domain) 0.000000767
Further Details:      
 
Domain Number 3 Region: 262-398
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000101
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 4 Region: 1046-1099
Classification Level Classification E-value
Superfamily SH3-domain 0.000000231
Family SH3-domain 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000013425
Domain Number - Region: 86-169
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.000157
Family CRAL/TRIO domain 0.01
Further Details:      
 
Domain Number - Region: 354-498
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00223
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000013425   Gene: ENSGMOG00000012544   Transcript: ENSGMOT00000013780
Sequence length 1118
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4648:8057:31950:-1 gene:ENSGMOG00000012544 transcript:ENSGMOT00000013780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DEIMQQECSPLGAADITPDLRKQFAFLSGGRGQNGSPIIVFPEFPAFGEILETEFHNVLT
YLTSVPSLSATGVGFVLVIDRRQDRWAAVKGTLLRIAGSFPGNLQLVLVLRPTTLLQRTL
SDILFKFNKDEFKMKVPVIMLSSVTELHSYIERSQLTQELGGTQEYCHEKWISHRTAIEG
FALMVKKTAQSLQVFGMELAETELPGDILATTSLLGTHTSKKDHMKGDMLVALAQGSRLL
ESINEPVVRDPDHNMTQDELENLATVQRLLSQLDETERAFDQFWARHQTKLTQCLQLRHF
EHNYKELMAQLDQVSEKLGTYSEVGISPAHADHIFRDLTNYEGKVCELLDRTAALAQEGD
SLIQNSHYAEDSLQSSCNELRALSSELSSTLRAKKDLLLQAMELHHSLERAAKWCDDGIY
LLASQPVDRCQSHEGAEAALLELERYLEAAGQNLLTDRATICTQYEAVLNQEFMDQVEKV
LQKQTSMQEMFEKRRISLKKLAAKQTRPVQPVAPRPEAIIKSPLNSPAHRAQQEKNLEGD
SGNDVSCKKDDGQQQNGGIHSRQASQSEQEENLAVLRRHVMNELLETERAYAEELLCVLQ
GYAAEMDNPAMAHLMPAALQNKKDVLFGNMLEIYHFHKRTFLGELEAYTDVPELVGRCFL
ERMTELQIYEKYCQNKPRSESLWRQCSDCAFFQECQKKLEHKLGLDSYLLKPVQRITKYQ
LLLKEMLKYSKGCEGTDDLQEALSSILGILKAVNDSMHLIAITGYEGNLTELGRLLMQGS
FSVWTEHKKGHAKVKDLARFKPMQRHLFLHEKALLFCKRREENGEGYEKAPSYSFKQSLS
MSAVGITENAKGDNKKFEIWCNSREEVYIVQAPSADVKTTWVNEIRKVLTTQLEAYRASQ
QRVPDQVLQFPPAPGRPSNSPLKSQRSLKKGEEKRAEPSPDALLLLSLLKGLDEIATSPT
SDRAAVAKKRFTLQGFSNLKPQKGSPTSPDHKTKRHEIKSDPTPFGFKGWTKASVSLDAS
GENDGYSSAEEPLNSDPEEEAPKRLSAGKYTVVADCERPGAQELAVASGDTVQLVKEGED
GQWFVQNLKTSKEGWVAAANLLTLIGPSQSCQSLTSSG
Download sequence
Identical sequences ENSGMOP00000013425 ENSGMOP00000013425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]