SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000013436 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000013436
Domain Number 1 Region: 240-441
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-49
Family DBL homology domain (DH-domain) 0.0000000298
Further Details:      
 
Domain Number 2 Region: 433-557
Classification Level Classification E-value
Superfamily PH domain-like 1.68e-30
Family Pleckstrin-homology domain (PH domain) 0.0000245
Further Details:      
 
Domain Number 3 Region: 164-234
Classification Level Classification E-value
Superfamily SH3-domain 6.04e-24
Family SH3-domain 0.0000664
Further Details:      
 
Domain Number 4 Region: 2-118
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.11e-23
Family Calponin-homology domain, CH-domain 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000013436   Gene: ENSGMOG00000012557   Transcript: ENSGMOT00000013792
Sequence length 802
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4648:193066:214401:-1 gene:ENSGMOG00000012557 transcript:ENSGMOT00000013792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSAEQTVTWLITLGVLESPKKTISDPEAFLQTSLRDGVVLCRLLERLSPGSTEKIYQEP
KNDAECLTNIKEFLKGCTSFRVEPFEASDLLLGLNFTKVLSSLVTLNKVTADIGVGSDSV
CARHSSAHRIKSFESLSSQTSLGRSSKLLQNQFRSLDMSENSGQQVLVKARFNFEQTNED
ELTFNKGDIIGVTRQEDGGWWEGMLNGRTGWFPSNYVRELKGCDKQVSPKSGTLKSPPKG
FDTTAISKTYYNLVLQNILETETEYSKDLQVLLTNYLRSLQSTDKMSSLDVALILGNLEE
ISTFQQMLVQSLEECTKLPEHQQRVGGFFLNLMPQMKALYTGYCSNHPSAVNVLTQHSEA
LGEFMEGRGAVSPGILTLTTGLSKPFMRLDRYPNLLKELERHMEESHPDRPDIQKCMATF
KNLSAQCQEVRKRKELELQILTEAIRLWEGDDIRTLGSVLYMSQAMVHSPGAEEKCERYL
MLFPHVLLLLSASPRMSGFIFQGKLPLTGMTMTKLEDCEAHKNAFELSGTMFERIQVVCN
NQQDLQDWVGHLTRQTKHTAATGPSHKPLNMPCHTLPSHPLTPSRHAEGRAMTVAPAYHT
LPHPSSHGTSHSTLMWGPLEPPNTPKPWSLSCLRPAPPLRPSAALCYKEDLSKSPKSVKK
LLPKRKPERKQSEEEFAVRKSTAALEEDAQILKVIEAYCTSAKTRQTLNSRLRKDSGLQV
IIPGEDKVLLEDPSRNGQTTMEEKSLVDVVYALRDEVQELKQDNKKMKRSLEEEQRARKD
LEKVVRRVLKTMNDPTWDETNL
Download sequence
Identical sequences ENSGMOP00000013436 ENSGMOP00000013436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]