SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000013491 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000013491
Domain Number 1 Region: 126-230
Classification Level Classification E-value
Superfamily Second domain of FERM 8.64e-33
Family Second domain of FERM 0.0000737
Further Details:      
 
Domain Number 2 Region: 228-377
Classification Level Classification E-value
Superfamily PH domain-like 1.05e-31
Family Third domain of FERM 0.0012
Further Details:      
 
Domain Number 3 Region: 41-123
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.82e-24
Family First domain of FERM 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000013491   Gene: ENSGMOG00000012613   Transcript: ENSGMOT00000013848
Sequence length 746
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1684:183550:226655:-1 gene:ENSGMOG00000012613 transcript:ENSGMOT00000013848 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSFLRRTLGRRSIRKHAEKTRLREAQHAITHIPAAGEAKSIITCRVSLLDGTDVSVDLP
KKAKGEELFEQIMYHLDIVEKDYFGLRFMDSAQVPHWLDVTKSIKKQVKIGPPYCLHLRV
KFYSSEPNNLHEELTRYLFVLQLKQDILSGKLECEFDTAVELGAFSLQAEMGDCDPAEHG
MDMVSEFRFSPEQTETMELAIYSTWKECRGQMPAQAEINYLNKAKWLEMYGVDMHMVKAR
DGNEYSLGLTPTGVLVFEGXXXXXXXXXPKITRLDFKKSKLTLVVVEDDEQVYXXXXXGK
EQEHTFVFRMDHPKACKHLWKCAVEHHAFFRLRGPVQKNSAQSGFIRMGSRFRYSGKTEY
QTTKANKARRSASFERRPSRRYSRRTMQNRGDXXXXXXVVSPAPSSACGPMEIEPLPRSP
GGEKRSLPLVADLLETCIDDVIRAPEAVPMATETEEAGPSGAHPPSVAVDDGLGQTEAAA
RLKQLELENSSLRVTPKNVNVNMALNNLKELGKLSDKSVLSAVGSSPVVTPRRPPEEQKS
NILKAQAEAAAHKGSLDDHSTLLGDKNCNLQPVLLKVRSGRMGSNSSLTLSSRPDRQEAR
EMLKPSSLGSPAGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXVKPDEMDPPPSDNLIDFT
DPTPVLPPVQQAKPLITPRWIIPTATPSCAFTNGLLDLDLTARLTPPPEKGRTPSPAIPL
LTQTHNIITSAQEDGARPKGLLTTEL
Download sequence
Identical sequences ENSGMOP00000013491 ENSGMOP00000013491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]