SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000013495 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000013495
Domain Number 1 Region: 627-906
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.53e-82
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000103
Further Details:      
 
Domain Number 2 Region: 215-361
Classification Level Classification E-value
Superfamily PH domain-like 4.61e-40
Family Third domain of FERM 0.0000964
Further Details:      
 
Domain Number 3 Region: 113-217
Classification Level Classification E-value
Superfamily Second domain of FERM 1.83e-34
Family Second domain of FERM 0.0001
Further Details:      
 
Domain Number 4 Region: 28-111
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.07e-20
Family First domain of FERM 0.0021
Further Details:      
 
Domain Number 5 Region: 516-608
Classification Level Classification E-value
Superfamily PDZ domain-like 1.2e-19
Family PDZ domain 0.0000241
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000013495   Gene: ENSGMOG00000012617   Transcript: ENSGMOT00000013852
Sequence length 921
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1684:235032:275333:-1 gene:ENSGMOG00000012617 transcript:ENSGMOT00000013852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSARFRCPAGRSYNVRATELERERHHAQVLCNILLLDHSMQPFTVSKCDLGQVLLDAVFK
HLELTERDYFGLHLAEDSSDTLRWLDPSKPIRKQLKRGSPHNLSFRVKFFVTDPGKLQEE
YTRYQYFLQIKQDILTGRLPCPHNTAALLASYAVQSELGDYSESENAPGYLSEFFFIPSP
PQDFHKEVTKHHQQHSGLSPAQSEFNYLNTARTLELYGVELHYARDQSNTEILIGVMSAG
VVIYKNRVRINYFPWLKIVKISFKCKQFFVQLRREPSETRETLLGFNMVNYRACKNLWKA
CVEHHTFFRLDRPVPPQKNFFTHYFTLGSKFRYCGRTEVQSVQYGKEKGIKDRVFARSPS
KPLARKLVDGTDWESVSRTSLSDERLETQSLPTRSPPGTPIQNSLFVQEGTRMRPSSVGH
LVDHVIHASPSLPVFSSNHKSASSTQANSISLDSXXSPEGVDGLPPALPPKQLSRKTLSQ
IIQAHSQQSLLDNHLNEMYDVPVNTDKTTLNGVVPHDNLVLIKIKPDEHGRFGFNVKGGA
DQKMPIIVSRVAPGTSADLCVPRLNEGDQVVLINGRDISDHTHDQVVMFIKASCESHSGE
LILLVRPNAIYDVVEEKADSEPDFQYIPEKSALDPGQTDQHAWRDSMVALKEGLISGALL
AQFDQLYRKRPGMTMLCAKLPQNVSKNRYRDISPYDATRVILKSTDDYINANYINMEIPA
SSLINRYIACQGPLPNTCPDFWQMSWEQGSSMVVMLTTQVKCHQYWPNPGNSATYGGFSV
TCHTEEGNAAFLVREMTLTHTQSEQERELTQIQYVAWPDHGVPDDSTDFLDFVALVRSKR
AGRDQPQCWDRTGVLVTMETALCLMEYGQPVHPLDIVRTMRDQRAMMIQTPSQYRFVCEA
ILKVFEEGLVSPVKAGLFQPR
Download sequence
Identical sequences ENSGMOP00000013495 ENSGMOP00000013495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]