SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000013568 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000013568
Domain Number 1 Region: 442-653
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.66e-55
Family DBL homology domain (DH-domain) 0.00022
Further Details:      
 
Domain Number 2 Region: 223-357
Classification Level Classification E-value
Superfamily BRCT domain 9.6e-22
Family DNA topoisomerase II binding protein 1, TopBP1 0.061
Further Details:      
 
Domain Number 3 Region: 133-254
Classification Level Classification E-value
Superfamily BRCT domain 1.19e-19
Family DNA ligase 0.047
Further Details:      
 
Domain Number 4 Region: 644-789
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000538
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000013568   Gene: ENSGMOG00000012674   Transcript: ENSGMOT00000013925
Sequence length 922
Comment pep:novel genescaffold:gadMor1:GeneScaffold_558:86582:125125:-1 gene:ENSGMOG00000012674 transcript:ENSGMOT00000013925 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADSSIVTSGMARSILVDSSVYDSRMAETTKDHGFLGPAMDDAEDMLPRLETRIILVGEA
SRNDLLIQALKAVKVMEVLVVKIRGAESGPEEKLMIKSIVNMDINKPCLMTDSVQEFADG
ENAEFESVYVLASFDSPDYSYLYERDNRIVGPPVILHCAAKEEPLPFSCRPLYSTTMINL
SLCFTGFRDKEEVKTLVNLVHHMGGTIRKDFSTKVTHLIAYSTHGEKYKLAVCMGTPILT
PSWIRKAWDSRDYVSFQADDEKFRTDFKVPPFQDCVLSFLGFSEEDKANMEERTLKHGGT
SLELGDERCTHMVVEENSVKELPFTPTKKLYVVKQEWFWGSIQMDARAGESMYFYEKDES
PAMKKAESLLSLNTPNSNRKRRRLRDTLAQLTKQTEISPFPPPRKRPSAEHSMGSLLDIS
NTPDNCKTLAESSKPNKSSTPMLTKQSARWQVTKELHQTESNYVDILNTILKLFKIPLEK
EGQVGGPILAQEEIKTIFGSIPDIYDVHRKIKGDLEELLNDWSEDKSVGNIILKYSKEML
KTYPSFVNFFEMSKDTIVKCEKLKPRFHAFLKINQSKPECGRQTLVELLIRPVQRLPSVG
LLLNDIKKHTSDDNPDKRTLERAIEALKEVMTHINEDKRKTEGQKQIFDVVYEVDGCPAN
LLSSHRSLVHRVETIALGDQPCDRGEQVTLFLFNDCLEIARKRHKVISTFKSPVGQTRPP
AQLKHIMLMPLSQIRKVLDLQDTEECVNAFALVVHPPTEQENLLFSFQLTGEETVKSDWL
RTLCRHVANTICRADSDDLIQRTSPEPLQVSTKDMDSTLSKASRAIKKTSKKVTRVFSFN
KTPKRVIQRAFMANGTTEEMSPRLSAESRFASSSTLAMSRSASTFSLSDSAKNSAIVQRS
NSLDHPPLRSRVSICVRDPCSP
Download sequence
Identical sequences ENSGMOP00000013568 ENSGMOP00000013568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]