SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000013614 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000013614
Domain Number 1 Region: 10-78
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.11e-17
Family Calponin-homology domain, CH-domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000013614   Gene: ENSGMOG00000012728   Transcript: ENSGMOT00000013973
Sequence length 85
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3473:103679:106085:-1 gene:ENSGMOG00000012728 transcript:ENSGMOT00000013973 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FQAVTGRSFAERDFRAALENGILLCQLLSCISPGLVKKINKLQTHIAGLENLCVFLRGCE
DLGLKGSQLFDPGDLQETSPRPTAK
Download sequence
Identical sequences ENSGMOP00000013614 ENSGMOP00000013614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]