SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000013618 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000013618
Domain Number 1 Region: 238-435
Classification Level Classification E-value
Superfamily MIR domain 7.24e-62
Family MIR domain 0.0000000963
Further Details:      
 
Domain Number 2 Region: 437-602
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 8.76e-53
Family IP3 receptor type 1 binding core, domain 2 0.000000409
Further Details:      
 
Domain Number 3 Region: 1093-1230
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 1.44e-31
Family IP3 receptor type 1 binding core, domain 2 0.0081
Further Details:      
 
Domain Number 4 Region: 110-216
Classification Level Classification E-value
Superfamily MIR domain 1.05e-18
Family MIR domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000013618   Gene: ENSGMOG00000012713   Transcript: ENSGMOT00000013977
Sequence length 2513
Comment pep:novel genescaffold:gadMor1:GeneScaffold_92:50162:105044:-1 gene:ENSGMOG00000012713 transcript:ENSGMOT00000013977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDSASSFLHIGDIVSLYAEGTVNGFISTLGLVDDRCVVEPAAGDLENPPKKFRDCLFKV
CPMSRYSAQKQFWKAKQAKHDKDKIGDLVLLQKLQHASNLEQKQNETENKKVHGDVVKYG
NVLQLLHMKSNKYLTVNKRLPALLEKNAMRVTLDGTGNEGSWLFIQPFWKLRANGDNVVV
GDKVMLNPVNAGQPLHASNYDLSDHPGCKEVNSVNCDTSWKINLFMMFSDHREEVLKGGD
VVRLFHAEQEKFLTCDEYRGKNQVFLRTTLRQSATSATSSNALWEVEVVHHDPCRGGAGH
WNSLYRFKHLATGNYLAAEENPGYKGDAPDLPFTGSVSGSRGNKRSQGERIKYKLVAVPH
GNDIASLFELDPTTLQKTDSFVPRNSYVRLRHLCTNTWIQGTNVPIDIEEDRPIRLMLGT
CPTKEDKEAFAIVSVPVMEIRDLDFANDASAMLSTVVEQFAQGFISQNDRRFAIKLLEDV
VFFVADVLNSGQLVLHVLMSKPNRERQKLMREQNILKQIFGILKAPFKDKGEGPLLQLEE
LADQKNAPYQYMLRLCYRVLRHSQEDYRKNQEHIAKQFGVMQSQIGYDILAEDTITALLH
NNRKLLEKHITKTEVETFVSLVRRNREPRFLDYLSDLCVSNNVAIPVTQELICKCVLEPK
NNDILIKTERRVPKEPATAGVQAEYLGIDDFVEDDEVWLVWTDKANEKQEKSIRQLAQEA
RQGNAHDENVLTYYRYQLKLFARMCLDRQYLAIDEISKQLDIELIFLCMMDETLPFDLRA
SFCRLMLHAHVDRDPQELVTPVKFARLWTEIPTTISIKDYDSNMDDSREGKKNRFSNTMV
FMEEYLNHVLHEELPFHNQEKNKLTYEVVSLARHLIYFGFYSFFELLRLTRTLLGIIDCW
PNRKNVKRSIHGMGQIMSTMVLNRKPSMFGGAGSRGAGPAADGGRASKDSIDNMDQTVMD
TKLKILEILQFILNVRLDYRISFLLSAFKKEFVEVANAMGDADATSTNLEQAKGNSILEV
DDEGGRMFLRVLIHLTMHRFPPLVSGALQLLFKHFSQRQEVLHTFKQVQLLITSQDVENY
KLIKADLDRLRTLVEKSELWVEKKDKKSGGEGKDKKDKGQXXXXXXXXXXXXXXXVLERL
NRMCSSGVWKKQQRLLKNMGAHKVMLDLLQVSYDKNDAKMQVIIRHTHVFLQKFCMGNQE
NQALLHKNLNLFLNPGLLEAETVQHIFNNNYQLCSEISEGVLGHFIHCLATHGRHVQYLN
FLHTIIKAEGKYVKKCQDMIMTELTNAGEEVVVFYNDKTSFATMLDLMAESREGVSENSP
LRYHISLVELLAACAEGKNVYTEIKCTSLLPLEDVVRVVTHDDCITEVKVAYVNFVNHCY
VDTEVEMKEIYTSNHIWQLFEDFTVDMARVCLKREKRLTDPILEKYLIHVVFDTITAFFS
SPFSENSTSLQTHHTIVTQLMQSSVRLLDCPWLQQQQGHVESCIRTLALTGCRSISLPLD
LEGHISIMLSSSTLNSLSRSNPNYKSSTRGIRPTTPSNPWDYKNIIEKLQDIIVTLEERL
KPLVEAELSVLVDVLHQPELLFLEGTEVRQRCEAGGFISKLIQHTMALMSSEEKLCIKVL
RTLQEMLIRTLEFDEKVLVQNYLYPNRKSTPKSELVDLGERDWPAIAAIQCRLDREGGTR
LFIDLVMSTKNDKIFQESIQLAICLLEGGNTEIQNSFYKLMMGDNKSEKFFKVLHDRMKE
AQTDIKATVTVNVGEMSIKANDKEMELLAGSPTMAGPASMAAQPVAEQEVEAEMGPVVTI
MKPILRFLQLLCENHNHDLQNFLRCQNNKTNYNLVCETLQFLDIMCGSTTGGLGLLGLYI
NESNVHLITQSLETLTEYCQGPCQENQTCIVTNECNGIDIITALILNDISPLCRYRXXXX
XXXXDNASKLLLALMESRHDSENAERILFNLRPRELLDVIKKAYQQESEFEGGEVSPREV
GHNIYILALQLARHNKVLLTLLKSLKKSQQDDESISSMQLNLNNRPLSQMLKAKTPTAVV
EPDPLEHYEKHTAQIEIVRDDRSMEQIVFPVHPICEYLTEESKIRVFNTTEQDEQGSKIT
HFFEQASFLHGEMEWQKKLRSMPVLFWFSRRMTLWGSISFNLAVFINLIIAFFYPYDSGQ
GTSSISTITPTTPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRACDTLLMCIVTVMNHGLRNGGGV
GDVLRKPSKNEPLFPARVLYDLLFYFIVIIIVLNLIFGVIIDTFADLRSEKQRKEEILKT
TCFICGLERDKFDNKTVSFEEHIKLEHNIWNYLYFIVLIREKNRTDYTGPESYVGLMIKN
KNLDWFPRMQAMSLVVSDGDGEQNEMRMLQDKLGSTAKVVTTLTSQLNELKEQ
Download sequence
Identical sequences ENSGMOP00000013618 ENSGMOP00000013618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]