SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000013627 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGMOP00000013627
Domain Number - Region: 101-185
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0892
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000013627   Gene: ENSGMOG00000012741   Transcript: ENSGMOT00000013986
Sequence length 212
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1031:162119:167886:1 gene:ENSGMOG00000012741 transcript:ENSGMOT00000013986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACTLEKVLGDARTLLERLKEHDNAAEGLIDQSGALSHRVRSMREVGHALPDKQPIENSD
LQELSKYKPHVLLTQENTQIKDLQRENKELWLSLEEHQYALELIMARYRKQMLQMMMGKK
ELDTKPVLILHQDHAKEVQGQLERICEMGQVMRRAVQVDDQHYCSVSQRLAQLEMENKEL
RDLMAISRSSVKIQREHSDPPAAVAPLDPPSD
Download sequence
Identical sequences ENSGMOP00000013627 ENSGMOP00000013627

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]