SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000013669 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000013669
Domain Number 1 Region: 19-275
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.12e-66
Family Calponin-homology domain, CH-domain 0.0000135
Further Details:      
 
Domain Number 2 Region: 2167-2278
Classification Level Classification E-value
Superfamily PH domain-like 7.67e-34
Family Pleckstrin-homology domain (PH domain) 0.0000118
Further Details:      
 
Domain Number 3 Region: 891-1046
Classification Level Classification E-value
Superfamily Spectrin repeat 9.82e-29
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 4 Region: 1633-1787
Classification Level Classification E-value
Superfamily Spectrin repeat 1.3e-28
Family Spectrin repeat 0.0026
Further Details:      
 
Domain Number 5 Region: 997-1152
Classification Level Classification E-value
Superfamily Spectrin repeat 4.08e-27
Family Spectrin repeat 0.0000277
Further Details:      
 
Domain Number 6 Region: 291-390
Classification Level Classification E-value
Superfamily Spectrin repeat 5.5e-24
Family Spectrin repeat 0.00017
Further Details:      
 
Domain Number 7 Region: 1214-1363
Classification Level Classification E-value
Superfamily Spectrin repeat 9.36e-23
Family Spectrin repeat 0.00078
Further Details:      
 
Domain Number 8 Region: 691-796
Classification Level Classification E-value
Superfamily Spectrin repeat 2.19e-22
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 9 Region: 1792-1895
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-18
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 10 Region: 1371-1469
Classification Level Classification E-value
Superfamily Spectrin repeat 8.64e-18
Family Spectrin repeat 0.00043
Further Details:      
 
Domain Number 11 Region: 444-521
Classification Level Classification E-value
Superfamily Spectrin repeat 2.22e-16
Family Spectrin repeat 0.0008
Further Details:      
 
Domain Number 12 Region: 495-594
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000144
Family Spectrin repeat 0.00097
Further Details:      
 
Domain Number 13 Region: 1973-2065
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000258
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 14 Region: 1567-1653
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000266
Family Spectrin repeat 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000013669
Domain Number - Region: 647-691
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000187
Family Spectrin repeat 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000013669   Gene: ENSGMOG00000012768   Transcript: ENSGMOT00000014030
Sequence length 2331
Comment pep:novel genescaffold:gadMor1:GeneScaffold_39:191:64072:1 gene:ENSGMOG00000012768 transcript:ENSGMOT00000014030 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMTSVEPMEVQQQYGDVNNRWDADDWDNENSSARLFERSRIKALADEREAVQKKTFTKWV
NSHLSRVSCRITDLYLDLRDGRSLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLK
EQRVHLENMGSHDIVDGNQRLTLGLIWTIILRFQIQDISVVTEDNKEKRSAKDALLLWCQ
MKTAGXXXXXXXXXXXXXXXXXXXXXXXXXXXPDLIDFDRLKKSNAHHNLQNAFNLAEQH
LGITKLLDXXXISVDHPDEKSIITYVVTYYHYFSKMKALKVEGKRIGKVLDNALESQKMI
DKYEGLSSDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNSYRTVEKPPKFTEKGNLEV
LLFTIQSRMRANNQKVYTPREGKLISDINKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXDNFGFDLQAVEAATKKHEAIETDIAAYEERVKAVVSV
ARELEAESYHDLKRVSARKDNVLRLWEYLLELLKARRQRLELTLGLQHVFQEMLHIMDWM
DEMKMLLLSQDYGKHLLGVEDLLQKHSLVETDISVQADRVRSVNNNAQKFAEDSEXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEGWIREKEQILSSE
DCGKDLTGAVRLLSGHRALEDETAGRAAHLAATVRQGEALVADGHFGADKIKERIQDIQE
QWAALENLSRLRKKSLQDACNKHQFQADADDMDTWMLDVLRIVSSVDVGHDEFSAQALVK
KHKDAAEEIASYRAIASLHEQARTLAVAGRLAGIEERYQEVVELSRLRRQALQDALALYR
LRSEAGSCEAWIEEKEQWLSSMEIPERLEDLEVVQHRFESLEPEMNSHASRVAVVNQVAR
QLLHSGHPTETEIKAQQDKLNTRWSSFRDLVDQKKEALQSALGIQNYHLDCNETKSWIRE
KTKVIESTQELGNDLAGVMALQRKLTGMERDLAAIEDKLGGLGTEAERLATQHPEQAQGI
RAQVVQLSSVWDEMKDTLKTREESLGESSKLQQFLRELDDFQSWLSRTQTAVASEDMPHT
LVEAEKLLAQHEGIHNEIRNYEEDYQKMRDMGEAVTQGQTDAQHMFLRQRLQALDTGWNE
LSKMWENRQNLLAQSHCYQTFLRDTKQAEAFLNNQEYVLAHTEMPATLQGAEASIKRQED
FRTTMDANEDKIVGVVEGGRRLVADGNVNGERIQEKVDSINQRHQKNQGSATDLLIKLKD
NRDLQRFLQDSQELALWVNEKMLTAQDMTYDEARNLHSKWLKHQAFMAELQANKEWLEKI
EKDGLVLIAEKPETETMVHEQLGTLQTMWAELESTTQTKAQCLFDANKAELFTQSCADLD
KWLGGLEGQIQSDDYGKDLTSVNILLKKQQMLESQVEVREREVGELQGQAQALRQEGKDG
EEVDGQRDGVEKKFMALQAPLKKRRENLMASREIHQFNRDVEDEIXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXTDRRHDRLAEANRAQQFYADAAEAEAWMGEQELHMMSEEKAKDEQSSVAMVKKH
QIVEQAVEDYADTVHLLSQTSRGLVAQGHPESERMGMRQAQVDKLYAGLKDLSEERRGKL
DERFRLFQLNREVDDLEQWVAEREVVAGSHELGQDYEHVTMLQERFREFARDTGTIGQER
VDAVNRQADQLINGGHGDAATVAEWKDGLNEAWADLLELIDTRTQILAASFELHKFYHDA
KEILGRILDKHKKLPEELGRDQNTVETLQRKHCTFQHDIQALGTQVRLLQEDAVRLQSAY
AGDKADDIQKREGEVLEAWQNLLEAAEGRRVRLADTGDKFRFFSLVRDLLLWMEDVIRLI
LNQENPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIKEKLLQ
LTDKRKDMIDKWEDRWEWXXXXLEVHQFSRDAGVAEAWLLGQEPYLSGREVGQSVDEVEK
LIKRHEAFEKSAATWEERFCALERLTTMELLEVRRLQEEEERLRRPPXXXXXXXXXXXXX
XEIEVEENGFPSEQDSPRXXXXXXXXXGDGEVVNGGSEPSPVGSPGDGRKGQAATLPAKT
QLAPPPSQLEGYLHRKHEWEGPNKKASSRSWHHVYCVLNQGELGFYKDQRSAVQGLPYHA
EVPVRLQGALGDVALDYKKKKHVFKLKLMDGNEYLFQAKDEEEMSSWISAVASACAPPPG
GLEVTPSSHSTPAATARAQTLPASVAIAAESSPGKREKDKEKRFSLFSKKK
Download sequence
Identical sequences ENSGMOP00000013669 ENSGMOP00000013669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]