SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000013760 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000013760
Domain Number 1 Region: 118-516
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.66e-113
Family Calponin-homology domain, CH-domain 0.0000000624
Further Details:      
 
Domain Number 2 Region: 4-139
Classification Level Classification E-value
Superfamily EF-hand 9.89e-16
Family Calmodulin-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000013760   Gene: ENSGMOG00000012859   Transcript: ENSGMOT00000014122
Sequence length 529
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2006:41036:52149:1 gene:ENSGMOG00000012859 transcript:ENSGMOT00000014122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENITQISREDLEELREAFNRIDIDNSGYVSDFELQELFREASFSLPGYRVREIVETFIA
GDTNKDEKISFEEFVSIYQELKSKEFSESFRKIIARKDGIRSFGGMSGISSEGTQHSYSD
EEKVAFVNWINKALDKDPDCSHLLPMNPQNDSLFKSVRDGILLCKMVNLSQNDTIDERVI
NTKKMSTFTMTENLVLALNSASAIGCTVVNIDASDLMAGKPHLVLGLLWQIIKTGLLADI
EIGRNEALIGLLGEGEDLDHLLSISPEELLLRWVNTHLTNAGTQTIRNFSEDIKDSRAYF
YLLDQISPKGEREDELAVIIDMSGLRERDLNQRAELMLKQAARMECRQFVSPHDVTSGNS
KLNLAFVANLYHMHPESREEKTFRNWMNSLGVAPYVHHLYRDLRDSMVIFQLFEKMNVSV
DWKKVNPSPYPVLGANMKKLENCNYAVELGKEAAQFSLVGVGGVNLNEGSSLHTLALLWQ
LMRKQDKLISTSLPVLDLIDTIVPSAVKQEMIKRAEKGVLSETDKFNNA
Download sequence
Identical sequences ENSGMOP00000013760 ENSGMOP00000013760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]