SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000013840 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000013840
Domain Number 1 Region: 251-376
Classification Level Classification E-value
Superfamily PH domain-like 2.92e-32
Family Phosphotyrosine-binding domain (PTB) 0.0001
Further Details:      
 
Domain Number 2 Region: 106-232
Classification Level Classification E-value
Superfamily SH2 domain 1.31e-19
Family SH2 domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000013840   Gene: ENSGMOG00000012936   Transcript: ENSGMOT00000014202
Sequence length 380
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3761:153436:160401:-1 gene:ENSGMOG00000012936 transcript:ENSGMOT00000014202 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RNSGNSMLSMSPGSDTSYMLGLSRPTYSCLSLASEDADSPDGLGTRTYGSFSNVSGTSCD
TRTSPTKPSLLDHCQGLQGYGSHSSPASLAGSLMDIPVVLVNGVFQAHFHGSQPSMKFVM
DTSKFWFRPHINRAEAEAMLKDRLPGVFVVRDSTSFRGSFGLVMKVDPYNVSPTGCHAVT
GESSSGAMRHFLIETSAKGVRIKGSPHEPFFGNLSALVYQHTITACALPCKLLTHGKSTD
LEEEEDESHDSTESDVKNKTASNFLFLNTVPTETLTGPCAVKKAVAATLEKHSKASITPT
IVNFRVSQKGVTLTDVKRKLFFRRHYPAHLLSYSGADPDNRLMFGFVAKGVEAGMENVCH
VFAEHDPLQTCGEAIDVMQG
Download sequence
Identical sequences ENSGMOP00000013840 ENSGMOP00000013840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]