SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000013879 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000013879
Domain Number 1 Region: 869-1031
Classification Level Classification E-value
Superfamily EF-hand 5.89e-26
Family Calmodulin-like 0.029
Further Details:      
 
Domain Number 2 Region: 723-854
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000046
Family Calmodulin-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000013879   Gene: ENSGMOG00000012965   Transcript: ENSGMOT00000014241
Sequence length 1123
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2006:217554:247580:1 gene:ENSGMOG00000012965 transcript:ENSGMOT00000014241 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAYRVVVSSVSCYNSVVVDRRVHKHAVHYCAGPCGAVSQGLDCAVAHRGTCSELLVAP
EHGPLDRNCSMHTYSHHMTYQVSAGHGGGGSMGNLASATSLKDITGEAINLASGKLKEFS
FDKLRLSASSHVTFRKGRKVRPDSFSRRSTDLDIIYGHFSSSVTTNGYAANASPVSGTGP
SNGSLSSACSGSLDQGLNTVASLYLNTLGEENLIARLLEKTRAEAGNGVGGEDIRACLDI
LLKCSEDLKKCTDIIKQCIRRKGPGGSGSDDEGANPESIYRAVMTRLSSYLKRLPLELEG
IGGLGRLVGGQGGPGAPSSGHSELAELVNSLHSIQQGPFSPIFGHDQPPRYEDVVQSPPL
PKPAAHYSSTSSSNSSSSSSSPSRAETVNAMQLQPNRVTTNGLQRSPHHHALPPPAFTHS
ASSPSSSPSHSPLPLYNHALPATPMEALHEEDADVGKSGEQSSPQAYTPSRGADVPQIRN
GTAYAKDTLPASPPRTLRNSVMNDDIDKLLLDLENLSQSMNHQREKEPPLPVKTRKMTGE
GGVIPVPLPGESHEVVVGGEEDGALLLRILESIESFAQELVDSGAGSTGSSERSSGKERE
VMRLLQDTLATAGRAETPPQSTQMSALATLLIQQTPAVIRXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXAPVLLPPPPQSAIHIPRFYYPRGLPVSGPPQNHDAAIAAAEAAFTE
FEEEKADIYEMAKIAKACGYPLYWKAPLFNAAGGERTGFVSVHSFIATWRKLLHSCHDDS
SMFICLLAKPSCSYLEQEDFIPLMQDIVDTHPGLTFLKDAPEFHSRYITTVIQRIFYVVN
RSWSGRVTMTELRRSNFLQTLALLEEEDDINQITDYFSYEHFYVIYCKFWELDTDHDLYI
DPKDLARYNDHASSNRIIERMFSGAVTRGNSVQRENRMSYAEFVWFLISEEDKKNPTSIE
YWFRCMDMDGDGVLSMFELEYFYEEQCERMEGMGIEPLPFQDLLCQMLDLVKPKSQGKIT
LSDLKRCRMAHIFLDTFFNLEKYLDHEQRDPFALQKDIDTEGPEPSDWDKYASEEYEILV
AEETANEQLHDASFDDDYESDELQVPGDIGNKMEKLVISDLTA
Download sequence
Identical sequences ENSGMOP00000013879 ENSGMOP00000013879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]