SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000013932 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000013932
Domain Number 1 Region: 198-393,463-510
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 7.15e-41
Family Phospholipase D 0.038
Further Details:      
 
Domain Number 2 Region: 517-730
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 8.75e-30
Family Nuclease 0.032
Further Details:      
 
Domain Number 3 Region: 1-112
Classification Level Classification E-value
Superfamily PX domain 0.0000000000131
Family PX domain 0.0081
Further Details:      
 
Domain Number 4 Region: 124-227
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000158
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000013932   Gene: ENSGMOG00000013012   Transcript: ENSGMOT00000014295
Sequence length 862
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2006:383043:404082:1 gene:ENSGMOG00000013012 transcript:ENSGMOT00000014295 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFKIELKHGEFSWVVRRKEKHFMELHRELLRYKTFMRIPLPSRSHTVRRKSVRKSEVREM
PSLPRGRGDELARDEQVSSRRKQLEDYINKLLRMAMYRKYHHTMEFIDVSQMSFIHDLGP
KGLEGMVYKRSGGYRIPGMNCCGHSKACYRWSKRWLVVKDSCLLYMKPDTGAIAFVLLVD
KEFSIKMDSKETETRHGVRIDNLSRSLVLKCSSFRHARWWGQSIESFVRAHGKAFLRDHR
FGSFAQEEENIPAKWYVNGRNYMEDVADALEEAQEEIFITDWWLSPEIFLKRPVVEGNRW
RLDCTLKRKAQQGVRIFVMLYKEVELALGINSGYSKRTLAHLHPNIKVMRHPDHVSSSVY
LWAHHEKLVVIDQSVAFVGGIDLAYGRWDDREHRLTDVGSVTHSVALEQPADSVSSLDST
DGVELLGNTRFWHGKDYCNFVYKDWIQLEKPFDDFIDRYTTPRMPWHDIASVVHGNAARD
VARHFIQRWNFTKIMKPKYRSLSYPCLLPKSHSCGSNLHYQVPDCVNTKVQVLRSAADWS
AGIKYHEESIHNAYVQVIIKSKHYIYIENQFFISCADNRMVYNKIGDAIIERIIRAHKEG
KRYRVYVVTPLLPGFEGDITTGGGNALQAVMHFNYRTMIRGECSIISQLKKEMDDQWMNY
IMFGGLRTHAELEEHLVTELIYVHSKMLIADDNTVIIGSANINDRSMLGKRDSEVAVIIQ
DSETVTAVMDEKEYQAGPYALQLRLECFRTILGGHSDATIDLSDPVSDRFYKDVWMATAG
RNATIYEKVFRCLPTSLVRNMSELEQYQVKAGLAQTDPIRAREELRKIRGFLVQFPLDFL
SEENLMPSVGTKEAMVPTEIWT
Download sequence
Identical sequences ENSGMOP00000013932 ENSGMOP00000013932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]